DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and Prss29

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_017453326.1 Gene:Prss29 / 287136 RGDID:1305856 Length:279 Species:Rattus norvegicus


Alignment Length:257 Identity:70/257 - (27%)
Similarity:122/257 - (47%) Gaps:44/257 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IVGGQNAAEGDAPYQVSLQTLLGS-----HLCGGAIISDRWIITAGHCV--KGYPTSRLQVATGT 84
            ||||.:|.:|..|:||||:....:     |:|||:||..:|::||.||:  .....|..::..|.
  Rat    31 IVGGNSAPQGKWPWQVSLRVYRYNWASWVHICGGSIIHPQWVLTAAHCIHESDADPSAFRIYLGQ 95

  Fly    85 IRYAEPGAVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPTSPFPRGASELVF- 148
            :.......:.....:.:|.::......:|:.||.|.:|:......:.|:|..:.......::.: 
  Rat    96 VYLYGGEKLLKVSRVIIHPDFVRSGLGSDVALLQLAQSVRSFPNVKPVKLSPASLEVTKKDVCWV 160

  Fly   149 TGWGSQSAAGSLPS--QLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANIG-------- 203
            |||||.|...|||.  :||:||.:.:::..||.:   |.:         |.|.:|.|        
  Rat   161 TGWGSVSMHESLPPPYRLQQVQVKIVDNTLCEKL---YRN---------ATRLSNHGQRLILQDM 213

  Fly   204 ---------ACHGDSGGPLV----HQGTLVGILNFFVPCA-QGVPDIFMNIMYYRDWMRQTM 251
                     :|:||||||||    ...||||::::...|| :.:|.::..:.::..|:...|
  Rat   214 LCAGSHGRDSCYGDSGGPLVCNVTGSWTLVGVVSWGYGCALKDIPGVYARVQFFLPWITGQM 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 69/254 (27%)
Tryp_SPc 27..246 CDD:214473 68/250 (27%)
Prss29XP_017453326.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.