DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and KLK9

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_036447.1 Gene:KLK9 / 284366 HGNCID:6370 Length:250 Species:Homo sapiens


Alignment Length:268 Identity:76/268 - (28%)
Similarity:116/268 - (43%) Gaps:56/268 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LYCDLLAL-------EHFIVGGQNAAEGDAPYQVSLQTLLGSHL----CGGAIISDRWIITAGHC 69
            |.|.||:|       :...:|.:.......|:|..|     .||    ||..:|||||::||.||
Human     5 LLCALLSLLAGHGWADTRAIGAEECRPNSQPWQAGL-----FHLTRLFCGATLISDRWLLTAAHC 64

  Fly    70 VKGYPTSRL------------QVATGTIRYAEPGAVYYPDAIYLHCNYDSPKYQNDIGLLHLNES 122
            .|.|...||            |:...|..:..||         .:.:..:..:.:||.|:.|...
Human    65 RKPYLWVRLGEHHLWKWEGPEQLFRVTDFFPHPG---------FNKDLSANDHNDDIMLIRLPRQ 120

  Fly   123 ITFNALTQAVELPTSPFPRGASELVFTGWGSQSAAGSL-PSQLQRVQQQHLNSPACESMMSAYED 186
            ...:...|.:.|..:....|...|: :|||:.|:..:| |..||......|.:..|.   .||  
Human   121 ARLSPAVQPLNLSQTCVSPGMQCLI-SGWGAVSSPKALFPVTLQCANISILENKLCH---WAY-- 179

  Fly   187 LELGPCHI-----CA-YRQANIGACHGDSGGPLVHQGTLVGILNFFV-PCAQ-GVPDIFMNIMYY 243
                |.||     || ..:...|:|.||||||||..|||.|:::... ||:: ..|.::.::.:|
Human   180 ----PGHISDSMLCAGLWEGGRGSCQGDSGGPLVCNGTLAGVVSGGAEPCSRPRRPAVYTSVCHY 240

  Fly   244 RDWMRQTM 251
            .||:::.|
Human   241 LDWIQEIM 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 70/247 (28%)
Tryp_SPc 27..246 CDD:214473 68/243 (28%)
KLK9NP_036447.1 Tryp_SPc 24..247 CDD:238113 70/246 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.