DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and CG33462

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster


Alignment Length:252 Identity:59/252 - (23%)
Similarity:100/252 - (39%) Gaps:29/252 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 NAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHCVK---------GYPTSRLQVATGTIRY 87
            ||.....|:...|:|..|.| |.|.:|:..:::||.|||.         |...::.:|.......
  Fly    41 NAKLAQNPWMAYLETPKGFH-CSGTLINHLFVLTAAHCVPDDLLITVRLGEYNTKTKVDCDNHLC 104

  Fly    88 AEPGAVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITF-NALTQAVELPTSPFPRGASELVF--- 148
            .||...|..|..:.|..|::....||||:|.|...:.: |.:.......::.|.....:|.:   
  Fly   105 QEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQLTWFTT 169

  Fly   149 TGWGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANIGACHGDSGGPL 213
            |.| .::||.:....|:.:.........|..:.......|    .|||....: ..|..|||.|.
  Fly   170 TVW-RETAANATSKVLRTMNIDRQPKETCSEIYGWNMTFE----QICAGNTLS-QLCSTDSGAPQ 228

  Fly   214 V----HQGT----LVGILNFFVPCAQGVPDIFMNIMYYRDWMRQTMSGNGKCAQVNQ 262
            :    |.|:    .:||.:......|. ..|.|:::.|.||:::.:...|....:|:
  Fly   229 IRKMWHNGSDRYVQLGIASRVKGQCQN-SGILMDLLSYADWIKRVVRQYGPSTDMNR 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 57/238 (24%)
Tryp_SPc 27..246 CDD:214473 55/234 (24%)
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 55/231 (24%)
Tryp_SPc 48..269 CDD:214473 54/228 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.