DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and CG33461

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster


Alignment Length:301 Identity:71/301 - (23%)
Similarity:117/301 - (38%) Gaps:73/301 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LARFLFYILVFSSLY----CDLL-ALEHFIVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRW 62
            ||.|:..:...||::    |.:: .|.:.|:.|..|..|..|:...|.|.. ..||.|::|:..:
  Fly    13 LALFVLGVHGSSSVFLEENCGVVPRLSYKIINGTPARLGRYPWMAFLHTPT-YFLCAGSLINQWF 76

  Fly    63 IITAGHCVK---------GYPTSRLQVATGTIRYAEPGAVYYPDAIYLHCNYDSPKYQNDIGLLH 118
            ::|:.||::         |.......:.....|..|....|..|.::.|..||...:.||||:|.
  Fly    77 VLTSAHCIEDDVELIARLGENNRDNDIDCENNRCLEATQEYNVDMLFKHRLYDPKDFSNDIGMLR 141

  Fly   119 LNESITFNALTQAVELPTSPFPRGASELVF--------TGWGSQSAAGSLPSQLQRVQQQHLNSP 175
            |...:.:....|    |...|.....:||.        ||||..|.              .||:.
  Fly   142 LERRVEYTYHIQ----PICIFHHRRMQLVVDQITWFKATGWGLTST--------------DLNTK 188

  Fly   176 ACESMMSAYEDLELGPCHICA--YRQANIGA-----------CHGDSGGPLVHQGTLV------- 220
            :...:|..  :|...|.:.||  ::|..:..           |.||||||   ||..|       
  Fly   189 SSRVLMEL--NLYRRPRNDCARIFKQNFLSGQICAGNDDGNLCRGDSGGP---QGRYVLIFGMKR 248

  Fly   221 ----GILNF-FVPCAQGVPDIFMNIMYYRDWMRQTMSGNGK 256
                ||.:| :..|::  ..|..:::.|..|:::.:...|:
  Fly   249 FVQMGIASFTYENCSK--VSILTDVVRYGRWIKKVVDWYGR 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 63/264 (24%)
Tryp_SPc 27..246 CDD:214473 62/260 (24%)
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 62/262 (24%)
Tryp_SPc 42..281 CDD:238113 63/264 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.