DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and Klk1c2

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_036809.1 Gene:Klk1c2 / 24841 RGDID:3888 Length:259 Species:Rattus norvegicus


Alignment Length:246 Identity:75/246 - (30%)
Similarity:118/246 - (47%) Gaps:30/246 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHCVKGYPTSRLQVATG--TIRYAE 89
            ||||....:...|:||:   ::..:||||.:|...|:|||.||.    ::..||..|  .:...|
  Rat    25 IVGGYKCEKNSQPWQVA---VINEYLCGGVLIDPSWVITAAHCY----SNNYQVLLGRNNLFKDE 82

  Fly    90 PGA--------VYYPDAIYLHCNYDSPK----YQNDIGLLHLNESITFNALTQAVELPTSPFPRG 142
            |.|        ..:||.|.|....|:.:    :.||:.||||:|........:.::|||.. |:.
  Rat    83 PFAQRRLVRQSFRHPDYIPLIVTNDTEQPVHDHSNDLMLLHLSEPADITGGVKVIDLPTKE-PKV 146

  Fly   143 ASELVFTGWGSQSAAGSLPS-QLQRVQQQHLNSPACESMMSAYEDLELGPCHICA-YRQANIGAC 205
            .|..:.:||||.:.:..:.| .||.|....|::..|   :..|:| .:....:|| ..:.....|
  Rat   147 GSTCLASGWGSTNPSEMVVSHDLQCVNIHLLSNEKC---IETYKD-NVTDVMLCAGEMEGGKDTC 207

  Fly   206 HGDSGGPLVHQGTLVGILN-FFVPCAQ-GVPDIFMNIMYYRDWMRQTMSGN 254
            .|||||||:..|.|.||.: ...|||: ..|.|:..::.:..|:::.|..|
  Rat   208 AGDSGGPLICDGVLQGITSGGATPCAKPKTPAIYAKLIKFTSWIKKVMKEN 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 73/240 (30%)
Tryp_SPc 27..246 CDD:214473 72/236 (31%)
Klk1c2NP_036809.1 Tryp_SPc 24..251 CDD:214473 72/237 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341223
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.