DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and CG30098

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster


Alignment Length:289 Identity:76/289 - (26%)
Similarity:114/289 - (39%) Gaps:70/289 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LARFLFYILVFSSLYCDLL-----ALEHF-IVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDR 61
            |..||..:.:.|..|..||     ||... ::|||||..  .|:...| .......|||::|:.|
  Fly     7 LLTFLVILTLGSYGYSQLLDSKCIALFRIRVIGGQNARR--TPWMAYL-IRDNRFACGGSLIAYR 68

  Fly    62 WIITAGHCVK----------GYPTSRLQVATGTIRYAEPGAVYYPDAIYLHCNYDSPKYQN-DIG 115
            :::||.||.|          .|.:||  ...|..|      .|...:||.|.||..  ::| ||.
  Fly    69 FVLTAAHCTKINDNLFVRLGEYDSSR--TTDGQTR------SYRVVSIYRHKNYID--FRNHDIA 123

  Fly   116 LLHLNESITFNALTQAV----ELPTSPFPRGASELVFTGWGSQSAAGSLPSQLQ-----RVQQQH 171
            :|.|:..:.::|..:.:    ................||||..:....:|:.||     ||:.::
  Fly   124 VLKLDRQVVYDAYIRPICILLNSGLQSLANSIQNFTLTGWGQMAHYYKMPTTLQEMSLRRVRNEY 188

  Fly   172 LNSPACESMMSAYEDLELGPCHICAYRQANIGACHGDSGGPLVHQGTLV-----------GILNF 225
            ...|:..               ||.:..... ||.|||||||   |:||           |:.|.
  Fly   189 CGVPSLS---------------ICCWNPVQY-ACFGDSGGPL---GSLVKYGHKTIYVQFGVTNS 234

  Fly   226 FVPCAQGVPDIFMNIMYYRDWMRQTMSGN 254
            ......|... ::::|.|..|:.||:..|
  Fly   235 VTGNCDGYSS-YLDLMSYMPWLYQTLLRN 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 64/253 (25%)
Tryp_SPc 27..246 CDD:214473 63/249 (25%)
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 63/250 (25%)
Tryp_SPc 37..258 CDD:238113 64/253 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.