DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and Prss58

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_778185.1 Gene:Prss58 / 232717 MGIID:3608323 Length:241 Species:Mus musculus


Alignment Length:267 Identity:71/267 - (26%)
Similarity:107/267 - (40%) Gaps:47/267 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFYILVFSSLYCDLLALEHFIVGGQNAAEGDAPYQVSLQTLLGSHL-CGGAIISDRWIITAGHCV 70
            |.::.:.|:|      |..|.....:.|....||.|.|::   .:| |.|.:|...|:|||.|| 
Mouse     3 LAFLCILSTL------LRTFAYNPDHIAGTTPPYLVYLKS---DYLPCTGVLIHPLWVITAAHC- 57

  Fly    71 KGYPTSRLQVATGTIRYAEP----GAVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQA 131
             ..|  .|||..|....|:|    ..|...:.|:.|.|:......:|:.|:.|...|..:...:|
Mouse    58 -NLP--NLQVILGITNPADPMERDVEVSDYEKIFHHPNFLVSSISHDLLLIKLKRRIKHSNYAKA 119

  Fly   132 VELPTSPFPRGASELVFTGWGSQSAAGSL------PSQLQRVQQQHLNSPACESMMSAYEDLELG 190
            |:||.......|...|.| |     |.:|      |..||.|....::...|.   :||:..::.
Mouse   120 VKLPQHIVSVNAMCSVST-W-----AYNLCDVTKDPDSLQTVNVTVISKAECR---NAYKAFDIT 175

  Fly   191 PCHICAYRQANIG-------ACHGDSGGPLVHQGTLVGILNFFVPCA-QGVPDIFMNIMYYRDWM 247
            ...||      :|       .|...:..|.|..|.|.|||::...|. :....|:.:|.:|..|:
Mouse   176 ENMIC------VGIVPGRRLPCKEVTAAPAVCNGVLYGILSYADGCVLRADVGIYASIFHYLPWI 234

  Fly   248 RQTMSGN 254
            ..||..|
Mouse   235 EDTMKNN 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 63/241 (26%)
Tryp_SPc 27..246 CDD:214473 62/237 (26%)
Prss58NP_778185.1 Tryp_SPc 29..237 CDD:238113 62/229 (27%)
Tryp_SPc 29..234 CDD:214473 61/226 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837502
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.