DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and PRSS54

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001073961.1 Gene:PRSS54 / 221191 HGNCID:26336 Length:395 Species:Homo sapiens


Alignment Length:304 Identity:69/304 - (22%)
Similarity:119/304 - (39%) Gaps:76/304 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVFSSLYCDLLALEHFIVGGQNAAEG-----DAPYQVSLQTLLGSHLCGGAIISDRWIITAGHCV 70
            |::||..|.:.....|.  |.:..||     :.|:.||||....:||..|.|:|:.|:::....:
Human    23 LLYSSTSCGVQKASVFY--GPDPKEGLVSSMEFPWVVSLQDSQYTHLAFGCILSEFWVLSIASAI 85

  Fly    71 KGYPTSRLQVATGTIRYAEPGAV---YYP-DAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQA 131
            :.  ...:.|..| |...:|..:   .|| :.|.:|.::|:....|:|.||..:.::.|..|.|:
Human    86 QN--RKDIVVIVG-ISNMDPSKIAHTEYPVNTIIIHEDFDNNSMSNNIALLKTDTAMHFGNLVQS 147

  Fly   132 V-----ELPTSPFPRGASELVFTGWGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGP 191
            :     .|.|.|.   ......:||...||.|:           |:.......:.  .:||::  
Human   148 ICFLGRMLHTPPV---LQNCWVSGWNPTSATGN-----------HMTMSVLRKIF--VKDLDM-- 194

  Fly   192 CHICAYRQANIG---------ACHGDSGGPLVHQ------GTLVGILNFFVPCAQGVPDIFM--N 239
            |.:...::...|         ||.||.|.|::.|      ..|.|:|||   ..:..|.:|:  .
Human   195 CPLYKLQKTECGSHTKEETKTACLGDPGSPMMCQLQQFDLWVLRGVLNF---GGETCPGLFLYTK 256

  Fly   240 IMYYRDWMRQ-------------------TMSGNGKCAQVNQQT 264
            :..|..|:..                   :.|.:|..|.:.|:|
Human   257 VEDYSKWITSKAERAGPPLSSLHHWEKLISFSHHGPNATMTQKT 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 59/272 (22%)
Tryp_SPc 27..246 CDD:214473 58/249 (23%)
PRSS54NP_001073961.1 Tryp_SPc 52..264 CDD:214473 55/235 (23%)
Tryp_SPc 52..264 CDD:238113 55/235 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..348
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147478
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.