DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and try-1

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_494910.2 Gene:try-1 / 173856 WormBaseID:WBGene00006619 Length:293 Species:Caenorhabditis elegans


Alignment Length:248 Identity:72/248 - (29%)
Similarity:122/248 - (49%) Gaps:22/248 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DLLALEHFIVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHCV--KGYPTSRLQVA 81
            |.:.|:|.::||..::....|:.|.|.:.||.|.|||::|...:::||.||.  ...||| ..|.
 Worm    50 DYVTLDHRLIGGSESSPHSWPWTVQLLSRLGHHRCGGSLIDPNFVLTAAHCFAKDRRPTS-YSVR 113

  Fly    82 TGTIRYAEPGAVYYPDAIYLH--CNYDSPKYQNDIGLLHLNESITFNALTQAVELPTSPFPRGAS 144
            .|..| :..|:.:...|:.:|  .|...|. ..|..::.::..:..:...:.:.||:.|    |.
 Worm   114 VGGHR-SGSGSPHRVTAVSIHPWYNIGFPS-SYDFAIMRIHPPVNTSTTARPICLPSLP----AV 172

  Fly   145 E---LVFTGWGSQSAAGSLPS-QLQRVQQQHLNSPACESMMSAYEDLELGPCHICA-YRQANIGA 204
            |   .|.|||||.....||.: .|:.:....|::..|.|:.:....:.| |..:|| |....|.:
 Worm   173 ENRLCVVTGWGSTIEGSSLSAPTLREIHVPLLSTLFCSSLPNYIGRIHL-PSMLCAGYSYGKIDS 236

  Fly   205 CHGDSGGPLV--HQG--TLVGILNFFVPCAQ-GVPDIFMNIMYYRDWMRQTMS 252
            |.|||||||:  ..|  .|.|::::.:.||: |:|.::.|:.....|:...|:
 Worm   237 CQGDSGGPLMCARDGHWELTGVVSWGIGCARPGMPGVYGNVHSASTWINLEMN 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 68/236 (29%)
Tryp_SPc 27..246 CDD:214473 67/232 (29%)
try-1NP_494910.2 Tryp_SPc 59..285 CDD:238113 68/233 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.