DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and Klk1b8

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_032483.1 Gene:Klk1b8 / 16624 MGIID:892018 Length:261 Species:Mus musculus


Alignment Length:284 Identity:75/284 - (26%)
Similarity:120/284 - (42%) Gaps:59/284 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RFLFYILVFSSLYCDLL-ALEHFIVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGH 68
            |||...|..|....|.. .|:..:|||.|..:...|:||::.. ...|:|||.::...|::||.|
Mouse     2 RFLILFLALSLGGIDAAPPLQSRVVGGFNCEKNSQPWQVAVYD-NKEHICGGVLLERNWVLTAAH 65

  Fly    69 CV--------------------------KGYPTSRLQVATGTIRYAEPGAVYYPDAIYLHCNYDS 107
            |.                          |.:|.....::..|::...|||               
Mouse    66 CYVDQYEVWLGKNKLFQEEPSAQHRLVSKSFPHPGFNMSLLTLKEIPPGA--------------- 115

  Fly   108 PKYQNDIGLLHLNESITFNALTQAVELPTSPFPRGASELVFTGWGS-QSAAGSLPSQLQRVQQQH 171
             .:.||:.||.|::........:.:.|||.....|::.|. :|||| .......|..||.|..:.
Mouse   116 -DFSNDLMLLRLSKPADITDAVKPITLPTKESKLGSTCLA-SGWGSITPTKWQKPDDLQCVFLKL 178

  Fly   172 LNSPAC-ESMMSAYEDLELGPCHICAYRQA---NIGACHGDSGGPLVHQGTLVGILNFF-VPCAQ 231
            |....| |:     .::::....:||...:   ||  |.|||||||:....|.||.:.. :||.:
Mouse   179 LPIKNCIEN-----HNVKVTDVMLCAGEMSGGKNI--CKGDSGGPLICDSVLQGITSTGPIPCGK 236

  Fly   232 -GVPDIFMNIMYYRDWMRQTMSGN 254
             |||.::.|::.:..|::.||:.|
Mouse   237 PGVPAMYTNLIKFNSWIKDTMTKN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 65/255 (25%)
Tryp_SPc 27..246 CDD:214473 64/251 (25%)
Klk1b8NP_032483.1 Tryp_SPc 24..253 CDD:214473 64/253 (25%)
Tryp_SPc 25..256 CDD:238113 65/255 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837501
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.