DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and Klk1b24

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_034773.1 Gene:Klk1b24 / 16617 MGIID:892021 Length:263 Species:Mus musculus


Alignment Length:273 Identity:75/273 - (27%)
Similarity:128/273 - (46%) Gaps:36/273 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFYILVFSSLYCDLL----ALEHFIVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAG 67
            ::::::|.:|....:    .::..:|||....:...|:.|:: .....::|||.:::..|::||.
Mouse     1 MWFLILFLALSLGGIDAAPPVQSRVVGGFKCEKNSQPWHVAV-FRYNKYICGGVLLNPNWVLTAA 64

  Fly    68 HCVKGYPTSRLQVATG--TIRYAEPGAVY--------YPDAIYLHCNYDSPK---YQNDIGLLHL 119
            ||. |..||:..|..|  .:...||.|.:        :||......|.|.|:   ..||:.||.|
Mouse    65 HCY-GNATSQYNVWLGKNKLFQREPSAQHRWVSKSFPHPDYNMSLLNDDIPQPKDKSNDLMLLRL 128

  Fly   120 NESITFNALTQAVELPTSPFPRGASELVFTGWGS-QSAAGSLPSQLQRVQQQHLNSPAC-ESMMS 182
            :|........:.::|||.. |:..|..:.:|||| .......|:.||.|..:.|.:..| :..:.
Mouse   129 SEPADITDAVKPIDLPTEE-PKLGSTCLASGWGSITPTKWQKPNDLQCVFIKLLPNENCTKPYLH 192

  Fly   183 AYEDLELGPCHICAYRQANIG----ACHGDSGGPLVHQGTLVGILNFF-VPCAQ-GVPDIFMNIM 241
            ...|:.|     ||   ..:|    .|.|||||||:..|.|.||.::. |||.: ..|.|:..::
Mouse   193 KVTDVML-----CA---GEMGGGKDTCAGDSGGPLICDGILHGITSWGPVPCGKPNAPAIYTKLI 249

  Fly   242 YYRDWMRQTMSGN 254
            .:..|::.||:.|
Mouse   250 KFASWIKDTMAKN 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 70/243 (29%)
Tryp_SPc 27..246 CDD:214473 69/239 (29%)
Klk1b24NP_034773.1 Tryp_SPc 24..255 CDD:214473 69/241 (29%)
Tryp_SPc 25..258 CDD:238113 70/243 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837503
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.