DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and CG43742

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:265 Identity:60/265 - (22%)
Similarity:107/265 - (40%) Gaps:44/265 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFYILVFSSLYCDLL------ALEHFIVGGQNAAEGD---APYQVSLQTLLGSHLCGGAIISDRW 62
            |..::::.:.:..||      .:.:.:..|..|....   |.|..|      ...|||::|..::
  Fly     9 LVAVVIYQNAFAQLLDENCKVKITYRVANGHTAITSQFMAALYNNS------EFFCGGSLIHKQY 67

  Fly    63 IITAGHCVKGYPTSRLQVATGTIRYAEP-----GAVYYPDAIYLHCNYDSPKYQNDIGLLHLNES 122
            ::||.|||:  ....:.|..|....:.|     ..:.....:.||.|:....:.|||.||.|...
  Fly    68 VLTAAHCVR--DLDEVTVHLGENNRSCPIPVCKHVLRLNAKVILHPNFHGNIFLNDIALLRLERE 130

  Fly   123 ITFNALTQAVELPTSPFPRGASELVFT--GWGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYE 185
            :.|.|..:.:.:.........::..||  ||| ::..|::...|..:....|....|      |:
  Fly   131 VIFEAHIRPICIILDEDVTSNNQNNFTAYGWG-KTEHGNISDVLSFIDLVRLPKSMC------YQ 188

  Fly   186 DLELGPCHICAYRQANIGACHGDSGGPL----VHQG----TLVGILNFFVPCAQGVPDIFMNIMY 242
            ::..    |||...:. ..|..||||||    ||:|    .|.||.::......|:..::.::..
  Fly   189 NINT----ICAGSTSG-DTCESDSGGPLIGNFVHRGKSRDILFGITSYGDAECSGLFGVYTDVNA 248

  Fly   243 YRDWM 247
            |:.|:
  Fly   249 YKSWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 57/239 (24%)
Tryp_SPc 27..246 CDD:214473 56/236 (24%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 56/238 (24%)
Tryp_SPc 35..256 CDD:238113 57/239 (24%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.