DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and PRSS58

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001001317.1 Gene:PRSS58 / 136541 HGNCID:39125 Length:241 Species:Homo sapiens


Alignment Length:225 Identity:58/225 - (25%)
Similarity:83/225 - (36%) Gaps:21/225 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PYQVSLQTLLGSHL-CGGAIISDRWIITAGHCVKGYPTSRLQVATGTIRYAEPG-----AVYYPD 97
            ||.|.|::   .:| |.|.:|...|:|||.||  ..|  :|:|..|....|:..     .:.|..
Human    29 PYLVYLKS---DYLPCAGVLIHPLWVITAAHC--NLP--KLRVILGVTIPADSNEKHLQVIGYEK 86

  Fly    98 AIYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPTSPFPRGASELVFTGWGSQSAAGSLPS 162
            .|: |.::......:||.|:.|......|...:...||...........|.|...:.......|.
Human    87 MIH-HPHFSVTSIDHDIMLIKLKTEAELNDYVKLANLPYQTISENTMCSVSTWSYNVCDIYKEPD 150

  Fly   163 QLQRVQQQHLNSPACESMMSAYEDLELGPC--HICAYRQANIGACHGDSGGPLVHQGTLVGILNF 225
            .||.|....::.|.|......|...|...|  .:...||    .|...|..|.:..|.|.|||:|
Human   151 SLQTVNISVISKPQCRDAYKTYNITENMLCVGIVPGRRQ----PCKEVSAAPAICNGMLQGILSF 211

  Fly   226 FVPCA-QGVPDIFMNIMYYRDWMRQTMSGN 254
            ...|. :....|:..|.||..|:...:..|
Human   212 ADGCVLRADVGIYAKIFYYIPWIENVIQNN 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 57/219 (26%)
Tryp_SPc 27..246 CDD:214473 56/215 (26%)
PRSS58NP_001001317.1 Tryp_SPc 29..234 CDD:214473 56/216 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147481
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.