DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and Klk1b22

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_034244.1 Gene:Klk1b22 / 13646 MGIID:95291 Length:259 Species:Mus musculus


Alignment Length:285 Identity:71/285 - (24%)
Similarity:123/285 - (43%) Gaps:63/285 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RFLFYILVFSSLYCDLL-ALEHFIVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGH 68
            |||...|..|....|.. .::..|:||....:...|:||::. .|..:||||.::...|::||.|
Mouse     2 RFLILFLTLSLGGIDAAPPVQSRILGGFKCEKNSQPWQVAVY-YLDEYLCGGVLLDRNWVLTAAH 65

  Fly    69 CVKGYPTSRLQVATGTIRYAEPGAVY------YPDAIYLHCNYDSPKYQ---------NDIGLLH 118
            |.:  ....:.:....:...||.|.:      :|     |.:::....|         ||:.||.
Mouse    66 CYE--DKYNIWLGKNKLFQDEPSAQHRLVSKSFP-----HPDFNMSLLQSVPTGADLSNDLMLLR 123

  Fly   119 LNESITFNALTQAVELPTSPFPRGASELVFTGWGSQSAAGSLPSQLQRVQQQHLNSPACESMMSA 183
            |::......:.:.::|||:. |:..|..:.:||||          :.::..|:.|...|.|    
Mouse   124 LSKPADITDVVKPIDLPTTE-PKLGSTCLASGWGS----------INQLIYQNPNDLQCVS---- 173

  Fly   184 YEDLELGPCHICAYRQANI-----------------GACHGDSGGPLVHQGTLVGILNF-FVPCA 230
               ::|.|..:|.  :|:|                 ..|.|||||||:..|.|.||.:: ..||.
Mouse   174 ---IKLHPNEVCV--KAHILKVTDVMLCAGEMNGGKDTCKGDSGGPLICDGVLQGITSWGSTPCG 233

  Fly   231 Q-GVPDIFMNIMYYRDWMRQTMSGN 254
            : ..|.|:..::.:..|::.||:.|
Mouse   234 EPNAPAIYTKLIKFTSWIKDTMAKN 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 62/256 (24%)
Tryp_SPc 27..246 CDD:214473 61/252 (24%)
Klk1b22NP_034244.1 Tryp_SPc 24..251 CDD:214473 61/254 (24%)
Tryp_SPc 25..254 CDD:238113 62/256 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837510
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.