DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and CG43336

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:290 Identity:67/290 - (23%)
Similarity:110/290 - (37%) Gaps:67/290 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLARFLFYIL---VFSSLYCDLLALEHF-----IVGGQNAAEGDAPYQVSLQTLLGSHLCGGAI 57
            :.|..||..:|   .|..:.|.:.|  |.     :..|..|:...:|:...|.:..|..:|||::
  Fly     6 VGLTFFLLPLLGSTQFLDMACGIRA--HSPSVPRVKNGTVASLTSSPWMAFLHSTDGRFICGGSL 68

  Fly    58 ISDRWIITAGHCV----------------------KGYPTSRLQVATGTIRYAEPGAVYYPDAIY 100
            |::|.::||.||.                      ..|.|.|::.      ..|.|        :
  Fly    69 ITNRLVLTAAHCFLDRTELVARLGEYDREEYEMCHDSYCTYRIEA------MVERG--------F 119

  Fly   101 LHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPTSP----FPRGASELVFTGWGSQSAAGSLP 161
            .|.:|:......||.:|.|...:.:....:.:.:...|    :......|..||||...:.|. .
  Fly   120 RHRHYNPMTMAYDIAILRLYRKVQYTDNIRPICIVIDPRWRKYIDSLDPLTGTGWGKTESEGD-S 183

  Fly   162 SQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANIGACHGDSGGP---LVHQG-----T 218
            ::|:.|.....:...|.    .|..|.|.....||..:.: ..|:||||||   |:..|     .
  Fly   184 AKLRTVDLARKHPEVCR----RYATLSLTANQFCAGNERS-NLCNGDSGGPVGALIPYGKSKRFV 243

  Fly   219 LVGILNFF-VPCAQGVPDIFMNIMYYRDWM 247
            .|||.:|. ..|.  :..:|.::|.|.||:
  Fly   244 QVGIASFTNTQCV--MVSVFTDVMSYVDWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 59/256 (23%)
Tryp_SPc 27..246 CDD:214473 57/253 (23%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 58/255 (23%)
Tryp_SPc 40..271 CDD:238113 58/252 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.