DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and CG43124

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001247345.1 Gene:CG43124 / 12798282 FlyBaseID:FBgn0262587 Length:245 Species:Drosophila melanogaster


Alignment Length:272 Identity:43/272 - (15%)
Similarity:93/272 - (34%) Gaps:66/272 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLARFLFYILVFSSLYCDLLALEHFIVGGQNAAEGDAPYQVSLQTLLGSH--LCGGAIISDRWI 63
            |:.||::...:|..........||...|.......|.: |...|..:|...  :|.||:|::.::
  Fly     1 MNTARWIVLCIVLMFYQGSAQTLEEDCVDHMERINGSS-YAPWLAEILSDSKVICAGALINNLYV 64

  Fly    64 ITAGHCVKGYPTSRLQVATGTIRYAEPGAVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNAL 128
            :||..|.|  ...:|.|..|:..:.:....:.....|....:......|::.:..|...:.|...
  Fly    65 LTAASCFK--ENEKLTVRLGSGYFDKSYENFRVTKAYFWMTHFPANNTNNLCIFRLQTEVEFKTH 127

  Fly   129 TQAVELPTSPFPRGASELVFTGWGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCH 193
            .:.:.:..||...|                 |.:..:.:.::......|:::...:         
  Fly   128 IRPMCITKSPKSLG-----------------LATTFEIINEKPKMWYFCKNIKGLF--------- 166

  Fly   194 ICAYRQANIGACHGD---------SGGP---LVHQGTLVGILNFFVPCAQGV---------PDIF 237
             |.|       ..|:         :|.|   .:..|...|::.:      |:         .:::
  Fly   167 -CKY-------VFGENEEKWQSKPTGSPWTETISNGPFKGLVRY------GILSYRDNKTYDEVY 217

  Fly   238 MNIMYYRDWMRQ 249
            :|:|.:.:|:.|
  Fly   218 INVMSHINWIAQ 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 37/246 (15%)
Tryp_SPc 27..246 CDD:214473 35/241 (15%)
CG43124NP_001247345.1 Tryp_SPc 41..>133 CDD:304450 17/93 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.