DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and Prss29

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_444490.2 Gene:Prss29 / 114662 MGIID:2149952 Length:279 Species:Mus musculus


Alignment Length:262 Identity:76/262 - (29%)
Similarity:122/262 - (46%) Gaps:54/262 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IVGGQNAAEGDAPYQVSLQT-----LLGSHLCGGAIISDRWIITAGHCVKGYPTS----RLQVAT 82
            ||||.:|.:|..|:||||:.     ....|.|||:||..:|::||.||::.....    |::|..
Mouse    31 IVGGHSAPQGKWPWQVSLRIYRYYWAFWVHNCGGSIIHPQWVLTAAHCIRERDADPSVFRIRVGE 95

  Fly    83 GTIRYAEPG--------AVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPTSPF 139
            .   |...|        .:.:||  ::|....|     |:.||.|..|:......:.|:||:...
Mouse    96 A---YLYGGKELLSVSRVIIHPD--FVHAGLGS-----DVALLQLAVSVQSFPNVKPVKLPSESL 150

  Fly   140 PRGASELVF-TGWGSQSAAGSLPS--QLQRVQQQHLNSPACESMMS------------AYEDLEL 189
            .....::.: ||||:.|...|||.  :||:||.:.:::..||.|..            ..:|:  
Mouse   151 EVTKKDVCWVTGWGAVSTHRSLPPPYRLQQVQVKIIDNSLCEEMYHNATRHRNRGQKLILKDM-- 213

  Fly   190 GPCHICAYRQANIGACHGDSGGPLV----HQGTLVGILNFFVPCA-QGVPDIFMNIMYYRDWMRQ 249
                :||..|.. .:|:||||||||    ...||||::::...|| :..|.::..:..:..|:.|
Mouse   214 ----LCAGNQGQ-DSCYGDSGGPLVCNVTGSWTLVGVVSWGYGCALRDFPGVYARVQSFLPWITQ 273

  Fly   250 TM 251
            .|
Mouse   274 QM 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 74/259 (29%)
Tryp_SPc 27..246 CDD:214473 73/255 (29%)
Prss29NP_444490.2 Tryp_SPc 31..274 CDD:238113 74/259 (29%)
Tryp_SPc 31..271 CDD:214473 73/256 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.