DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and Prss28

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_444489.2 Gene:Prss28 / 114661 MGIID:2149951 Length:274 Species:Mus musculus


Alignment Length:255 Identity:71/255 - (27%)
Similarity:115/255 - (45%) Gaps:46/255 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IVGGQNAAEGDAPYQVSLQTL---LGS--HLCGGAIISDRWIITAGHCVKGYPTSRLQVATGTIR 86
            |||||....|..|:||||:..   :.|  |:|||:||..:||:||.||::.      |.|...:.
Mouse    31 IVGGQCTPPGKWPWQVSLRMYSYEVNSWVHICGGSIIHPQWILTAAHCIQS------QDADPAVY 89

  Fly    87 YAEPGAVY-YPD-------AIYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELP--TSPFPR 141
            ..:.|.|| |.:       .|.:|.:|:....:.|:.|:.|...:..:.....|.||  :|.|. 
Mouse    90 RVQVGEVYLYKEQELLNISRIIIHPDYNDVSKRFDLALMQLTALLVTSTNVSPVSLPKDSSTFD- 153

  Fly   142 GASELVFTGWGS--QSAAGSLPSQLQRVQQQHLNSPACE-----------SMMSAYEDLELGPCH 193
            ...:....|||:  |......|.||..|:....::.:|:           ..::.::|:      
Mouse   154 STDQCWLVGWGNLLQRVPLQPPYQLHEVKIPIQDNKSCKRAYRKKSSDEHKAVAIFDDM------ 212

  Fly   194 ICAYRQANIGACHGDSGGPLV----HQGTLVGILNFFVPCAQGVPDIFMNIMYYRDWMRQ 249
            :||..... |.|.||||||||    ::...||:::..:.|:..:|.||..:.....|:.|
Mouse   213 LCAGTSGR-GPCFGDSGGPLVCWKSNKWIQVGVVSKGIDCSNNLPSIFSRVQSSLAWIHQ 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 71/255 (28%)
Tryp_SPc 27..246 CDD:214473 69/250 (28%)
Prss28NP_444489.2 Tryp_SPc 31..272 CDD:238113 71/255 (28%)
Tryp_SPc 31..269 CDD:214473 69/251 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.