DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and KLK8

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_653088.1 Gene:KLK8 / 11202 HGNCID:6369 Length:305 Species:Homo sapiens


Alignment Length:248 Identity:69/248 - (27%)
Similarity:104/248 - (41%) Gaps:29/248 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ALEHFIVGGQNAAEGDAPYQVSL---QTLLGSHLCGGAIISDRWIITAGHCVKGYPTSR-----L 78
            |.|..::||........|:|.:|   |.|    ||||.::...|::||.||.|...|.|     |
Human    73 AQEDKVLGGHECQPHSQPWQAALFQGQQL----LCGGVLVGGNWVLTAAHCKKPKYTVRLGDHSL 133

  Fly    79 QVATGTIRYAEPGAVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELP---TSPFP 140
            |...|. ....|.....|...|  .:.|...:.:|:.||.|.:..:..:..:.:.|.   |.|  
Human   134 QNKDGP-EQEIPVVQSIPHPCY--NSSDVEDHNHDLMLLQLRDQASLGSKVKPISLADHCTQP-- 193

  Fly   141 RGASELVFTGWGS-QSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANIGA 204
              ..:...:|||: .|...:.|..|...:.:......||   .||.. ::....:||........
Human   194 --GQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCE---DAYPG-QITDGMVCAGSSKGADT 252

  Fly   205 CHGDSGGPLVHQGTLVGILNF-FVPCAQG-VPDIFMNIMYYRDWMRQTMSGNG 255
            |.||||||||..|.|.||.:: ..||.:. .|.::.||..|.||:::.:...|
Human   253 CQGDSGGPLVCDGALQGITSWGSDPCGRSDKPGVYTNICRYLDWIKKIIGSKG 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 66/236 (28%)
Tryp_SPc 27..246 CDD:214473 64/232 (28%)
KLK8NP_653088.1 Tryp_SPc 77..297 CDD:214473 65/234 (28%)
Tryp_SPc 78..300 CDD:238113 66/236 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147483
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.