DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and KLK11

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_011524671.1 Gene:KLK11 / 11012 HGNCID:6359 Length:307 Species:Homo sapiens


Alignment Length:285 Identity:75/285 - (26%)
Similarity:119/285 - (41%) Gaps:67/285 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LLALEHFIVGGQ-------NAAEGDAPYQVSL--QTLLGSHLCGGAIISDRWIITAGHCVK---- 71
            ||||...:|||:       .......|:|.:|  :|.|   |||..:|:.||::||.||:|    
Human    40 LLALATGLVGGETRIIKGFECKPHSQPWQAALFEKTRL---LCGATLIAPRWLLTAAHCLKPWVS 101

  Fly    72 --------------GYPTSRL-------------------QVATGTIRYAEPGAVYYPDAIYLHC 103
                          .|..|.|                   |..|.|..:..||         .:.
Human   102 LTSPTHVSPDLSSSNYCLSHLSRYIVHLGQHNLQKEEGCEQTRTATESFPHPG---------FNN 157

  Fly   104 NYDSPKYQNDIGLLHLNESITFNALTQAVELPTSPFPRGASELVFTGWGSQSAAG-SLPSQLQRV 167
            :..:..::|||.|:.:...::.....:.:.|.:.....|.|.|: :||||.|:.. .||..|:..
Human   158 SLPNKDHRNDIMLVKMASPVSITWAVRPLTLSSRCVTAGTSCLI-SGWGSTSSPQLRLPHTLRCA 221

  Fly   168 QQQHLNSPACESMMSAYEDLELGPCHICA-YRQANIGACHGDSGGPLVHQGTLVGILNFFV-PCA 230
            ....:....||   :||.. .:....:|| .::....:|.||||||||...:|.||:::.. |||
Human   222 NITIIEHQKCE---NAYPG-NITDTMVCASVQEGGKDSCQGDSGGPLVCNQSLQGIISWGQDPCA 282

  Fly   231 -QGVPDIFMNIMYYRDWMRQTMSGN 254
             ...|.::..:..|.||:::||..|
Human   283 ITRKPGVYTKVCKYVDWIQETMKNN 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 68/272 (25%)
Tryp_SPc 27..246 CDD:214473 66/268 (25%)
KLK11XP_011524671.1 Tryp_SPc 53..300 CDD:214473 64/263 (24%)
Tryp_SPc 54..303 CDD:238113 65/265 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.