DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and LOC102554637

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_017448472.2 Gene:LOC102554637 / 102554637 RGDID:7618053 Length:246 Species:Rattus norvegicus


Alignment Length:237 Identity:82/237 - (34%)
Similarity:125/237 - (52%) Gaps:23/237 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHCVKGYPTSRLQVATG--TIRYAE 89
            ||||....|...||||||.:  |.|.|||::|:|:|:::|.||.|    ||:||..|  .|...|
  Rat    24 IVGGYTCQEHSVPYQVSLNS--GYHYCGGSLINDQWVVSAAHCYK----SRIQVRLGEHNINVLE 82

  Fly    90 PGAVYYPDA--IYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPTSPFPRGASELVFTGWG 152
             |...:.:|  |..|.|:|.....|||.|:.|:..:..||....|.||:|..|.| ::.:.:|||
  Rat    83 -GDEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAG-TQCLISGWG 145

  Fly   153 SQSAAG-SLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICA-YRQANIGACHGDSGGPLVH 215
            :..:.| :.|..||.:....|....||:....    ::....:|| :.:....:|.||||||:|.
  Rat   146 NTLSFGVNDPDLLQCLDAPLLPQADCEASYPG----KITNNMVCAGFLEGGKDSCQGDSGGPVVC 206

  Fly   216 QGTLVGILNFFVPCAQGVPD---IFMNIMYYRDWMRQTMSGN 254
            .|.|.||:::...||  :||   ::..:..|.||::.|::.|
  Rat   207 NGELQGIVSWGYGCA--LPDNPGVYTKVCNYVDWIQDTIAVN 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 80/231 (35%)
Tryp_SPc 27..246 CDD:214473 78/227 (34%)
LOC102554637XP_017448472.2 Tryp_SPc 24..242 CDD:238113 80/231 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.