DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and CG42694

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:238 Identity:53/238 - (22%)
Similarity:99/238 - (41%) Gaps:39/238 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GSH-LCGGAIISDRWIITAGHCVKGYPTSRLQVATGTIRYAEPGAVYYPDAIYLHCNYDSPKYQN 112
            |:| ||.|::||.:::::|..|:..:  .:|.|..| :..|.....:|..:..:..::...:.|.
  Fly    53 GTHVLCSGSLISKQFVLSAAQCIDVH--GKLFVQLG-VSNATKSPHWYTVSNVVIPSHSGKRLQR 114

  Fly   113 DIGLLHLNESITFN----ALTQAVELPTSPFPRGASELVFTGWGSQSAAGSLPSQLQRVQQQHLN 173
            |||||.|::|:.:|    .:..|:...|....:.......:.|.|::      ...|.:....|:
  Fly   115 DIGLLKLSQSVDYNDFVYPICIALNTNTLDMVKILQNFTTSAWLSKN------KNPQTIVLSQLS 173

  Fly   174 SPACESMMSAYEDLELGPCHICAYRQANIGACHGDSGG----PLVHQGTLV--------GILNFF 226
            ...|:..:|.    .:.|..|||.......:|..|||.    |::....:|        |.:|..
  Fly   174 RDRCKLNLSG----NVTPKEICAASLQRNNSCFIDSGSALTQPIIQGSNIVREMLFGIRGYVNGR 234

  Fly   227 VPCAQGVPDIFMNIMYYRDWMR---QTMSGNGKCA----QVNQ 262
            ..|::  |.|::::.....|:.   |...|....|    :|||
  Fly   235 SWCSE--PAIYIDVAECVGWIETVVQQYDGTDSRAVATPEVNQ 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 47/220 (21%)
Tryp_SPc 27..246 CDD:214473 46/213 (22%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 47/217 (22%)
Tryp_SPc 46..253 CDD:214473 46/214 (21%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.