DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and LOC101730988

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_012810074.1 Gene:LOC101730988 / 101730988 -ID:- Length:243 Species:Xenopus tropicalis


Alignment Length:249 Identity:83/249 - (33%)
Similarity:127/249 - (51%) Gaps:20/249 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LYCDLLAL-----EHFIVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHCVKGYPT 75
            |.|.||..     :..|:||...|:...||.|||..  |.|.|||::::::|:::|.||   |..
 Frog     5 LICVLLGAAAAFDDDKIIGGATCAKNSVPYIVSLNA--GYHFCGGSLLNNQWVVSAAHC---YQA 64

  Fly    76 SRLQVATG--TIRYAEPGAVYYPDA-IYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPTS 137
            | :||..|  .|..:|....:...| :..|.:|:|....|||.|:.|....:.|:..:||.||:|
 Frog    65 S-IQVRLGEHNIALSEGTEQFINSAKVIRHPSYNSRTTDNDIMLIKLASPASLNSYVKAVSLPSS 128

  Fly   138 PFPRGASELVFTGWGSQSAAGS-LPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQAN 201
            ....|.|.|| :|||:.||:|| .|:.||.:....|.:..|.   |||............:.:..
 Frog   129 CAAAGTSCLV-SGWGNTSASGSNYPNLLQCLNAPILTTAQCS---SAYPGQITNNMFCAGFLEGG 189

  Fly   202 IGACHGDSGGPLVHQGTLVGILNFFVPCAQ-GVPDIFMNIMYYRDWMRQTMSGN 254
            ..:|.||||||:|..|.|.||:::.:.||| ..|.::..:..|..|::.|::.|
 Frog   190 KDSCQGDSGGPVVCNGQLQGIVSWGIGCAQRNYPGVYAKVCNYNSWIQSTIAAN 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 77/227 (34%)
Tryp_SPc 27..246 CDD:214473 76/223 (34%)
LOC101730988XP_012810074.1 Tryp_SPc 21..239 CDD:238113 77/227 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.