DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and LOC101730792

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_031762443.1 Gene:LOC101730792 / 101730792 -ID:- Length:146 Species:Xenopus tropicalis


Alignment Length:157 Identity:42/157 - (26%)
Similarity:63/157 - (40%) Gaps:40/157 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 LLHLNESITFNALTQAVELP---TSPFPRGASELVFTGWGSQSAAGSLPSQLQR------VQQQH 171
            ||.||....:||....|.||   .||......::  :|||..|..|..||...|      |..:.
 Frog     8 LLPLNRPAFYNAFVSVVPLPIQGVSPIEGRLCQV--SGWGFTSTIGGKPSDTLRSVKLPIVPMRK 70

  Fly   172 LNSPA-----------CESMMSAYEDLELGPCHICAYRQANIGACHGDSGGPLVHQGTLVGILNF 225
            .||.|           |...::..:|                 ||.||||||||..|.:.|::::
 Frog    71 CNSSASYAGHITSNMICAGFITGGKD-----------------ACQGDSGGPLVCDGKVYGVVSW 118

  Fly   226 FVPCAQ-GVPDIFMNIMYYRDWMRQTM 251
            ...||. ..|.::..:..::.|:.:|:
 Frog   119 GHSCANPKYPGVYTAVANFQRWIYRTI 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 41/154 (27%)
Tryp_SPc 27..246 CDD:214473 40/150 (27%)
LOC101730792XP_031762443.1 Tryp_SPc <7..141 CDD:214473 40/151 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.