DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and Klk9

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_082936.2 Gene:Klk9 / 101533 MGIID:1921082 Length:251 Species:Mus musculus


Alignment Length:265 Identity:82/265 - (30%)
Similarity:118/265 - (44%) Gaps:41/265 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVFSSLYCDLLALEHFIVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHCVKGYPT 75
            ||..||.......:...||.:.......|:|..| ..|...|||..:|:|:|::||.||.|.|..
Mouse     7 LVLFSLLAGHCGADTRAVGARECVRNSQPWQAGL-FYLTRQLCGATLINDQWLLTAAHCRKPYLW 70

  Fly    76 SRL------------QVATGTIRYAEPGAVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNAL 128
            .||            |:...|..:..||  :.||   |..|    .:.:||.|:.|...:.....
Mouse    71 VRLGEHHLWRWEGPEQLLLVTDFFPHPG--FNPD---LSAN----DHNDDIMLIRLPRKVRLTPA 126

  Fly   129 TQAVELPTSPFPRGASELVFTGWGSQSAAG-SLPSQLQRVQQQHLNSPACESMMSAYEDLELGPC 192
            .|.:.|..|..|.| ::.:.:||||.|::. ..|..||......|::..|.   .||      |.
Mouse   127 VQPLNLTESRPPVG-TQCLISGWGSVSSSKLQYPMTLQCANISILDNKLCR---WAY------PG 181

  Fly   193 HI-----CA-YRQANIGACHGDSGGPLVHQGTLVGILN-FFVPCAQ-GVPDIFMNIMYYRDWMRQ 249
            ||     || ..:...|:|.||||||||.:|||.||:: ...||:: ..|.::.|:..|.:|:..
Mouse   182 HISEKMLCAGLWEGGRGSCQGDSGGPLVCEGTLAGIVSGGSEPCSRPRRPAVYTNVFDYLEWIES 246

  Fly   250 TMSGN 254
            ||..|
Mouse   247 TMEKN 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 75/243 (31%)
Tryp_SPc 27..246 CDD:214473 74/239 (31%)
Klk9NP_082936.2 Tryp_SPc 24..247 CDD:238113 75/242 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.