DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17477 and zgc:171509

DIOPT Version :9

Sequence 1:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001307362.1 Gene:zgc:171509 / 100141339 ZFINID:ZDB-GENE-080219-48 Length:240 Species:Danio rerio


Alignment Length:232 Identity:68/232 - (29%)
Similarity:110/232 - (47%) Gaps:16/232 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHCVKGYPTSRLQVATG---TIRYA 88
            |:||........|:|..|..  |..||||::|.:.|:::|.||    .:|.:.|..|   .....
Zfish    21 IIGGHECQPHSQPWQARLDD--GYGLCGGSLIHESWVVSAAHC----KSSSIIVHLGKHDLFVVE 79

  Fly    89 EPGAVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPTSPFPRGASELVFTGWGS 153
            :.......:.:..|..|::.::.|||.|:.|.|....|...:.|.|||:....|...|| :||| 
Zfish    80 DTAQEIQAEKVISHPKYNNREHNNDIMLIKLREPAVINNNVKPVPLPTNCSHAGEQCLV-SGWG- 142

  Fly   154 QSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANIGACHGDSGGPLVHQGT 218
             ....|:.|.||.::...|:...|:   |||..:.........:......:|.||||||:|..||
Zfish   143 -VTGDSISSTLQCLELPILSKADCK---SAYGRVITKKMFCAGFMDGGKDSCQGDSGGPVVCNGT 203

  Fly   219 LVGILNFFVPCAQ-GVPDIFMNIMYYRDWMRQTMSGN 254
            |.||::|.:.||: |.|.:::.:..|.:|:...::.|
Zfish   204 LKGIVSFGIGCAEPGFPGVYVEVCRYINWINYIIANN 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 67/226 (30%)
Tryp_SPc 27..246 CDD:214473 66/222 (30%)
zgc:171509NP_001307362.1 Tryp_SPc 20..233 CDD:214473 66/223 (30%)
Tryp_SPc 21..234 CDD:238113 67/224 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.