DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GckIII and STK3

DIOPT Version :9

Sequence 1:NP_650596.1 Gene:GckIII / 42064 FlyBaseID:FBgn0266465 Length:642 Species:Drosophila melanogaster
Sequence 2:XP_016869245.1 Gene:STK3 / 6788 HGNCID:11406 Length:580 Species:Homo sapiens


Alignment Length:429 Identity:174/429 - (40%)
Similarity:241/429 - (56%) Gaps:60/429 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PELIFTKQERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIDDIQQEIMVLSQCDSPYVTK 73
            ||.:|...|::|:||:|.|||.|...:.||||||.:.:   |.::.:|.:||.::.|||||||.|
Human   108 PEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPV---ESDLQEIIKEISIMQQCDSPYVVK 169

  Fly    74 YYGSFLKGTKLWIIMEYLGGGSALDL--MKAGSFEEMHIGIILREVLKGLDYLHSERKLHRDIKA 136
            ||||:.|.|.|||:|||.|.||..|:  ::..:..|..|..||:..||||:|||..||:||||||
Human   170 YYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGLEYLHFMRKIHRDIKA 234

  Fly   137 ANVLLSEQGDVKLADFGVAGQLTNTTSKRNTFVGTPFWMAPEVIKQSQYDAKADIWSLGITAIEL 201
            .|:||:.:|..||||||||||||:|.:||||.:|||||||||||::..|:..|||||||||:||:
Human   235 GNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEM 299

  Fly   202 AKGEPPNSELHPMRVLFLIPKNNPPQLTGS--YTKSFKDFVEACLNKDPENRPTAKELLKYPFIK 264
            |:|:||.:::||||.:|:||.|.||.....  ::..|.|||:.||.|:||.|.||.:||::||||
Human   300 AEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFIK 364

  Fly   265 KAKKNAYLIDLIDRFKKWKVSKGDESETESENSDSDSDAKQGGSSQDEPWIMTVKGLHINSAPRA 329
            .||..:.|.|||....:.|..:.:|.:.|.|..:.:||       :||                 
Human   365 NAKPVSILRDLITEAMEIKAKRHEEQQRELEEEEENSD-------EDE----------------- 405

  Fly   330 GVNSFQLQEHELTMQK-------LMQTTHSPAGGGGVQASPAANALSSSVSAVAASASSVSVITA 387
                  |..|  ||.|       .|:.|.:.:.|........:..|.|.:..:..::....   .
Human   406 ------LDSH--TMVKTSVESVGTMRATSTMSEGAQTMIEHNSTMLESDLGTMVINSEDEE---E 459

  Fly   388 NEGVSSASALPPQ-----------NSHVHNHNHNNINNN 415
            .:|....:|..||           .....|.:|.|.|.|
Human   460 EDGTMKRNATSPQVQRPSFMDYFDKQDFKNKSHENCNQN 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GckIIINP_650596.1 STKc_MST3_like 12..283 CDD:270786 145/274 (53%)
S_TKc 13..263 CDD:214567 136/253 (54%)
STK3XP_016869245.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D967913at2759
OrthoFinder 1 1.000 - - FOG0000324
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.