DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GckIII and Stk4

DIOPT Version :9

Sequence 1:NP_650596.1 Gene:GckIII / 42064 FlyBaseID:FBgn0266465 Length:642 Species:Drosophila melanogaster
Sequence 2:NP_067395.1 Gene:Stk4 / 58231 MGIID:1929004 Length:487 Species:Mus musculus


Alignment Length:355 Identity:164/355 - (46%)
Similarity:231/355 - (65%) Gaps:27/355 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PELIFTKQERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIDDIQQEIMVLSQCDSPYVTK 73
            ||.:|...|::|:||:|.|:|.|...|.|:||||.:.:   |.::.:|.:||.::.|||||:|.|
Mouse    26 PEEVFDVLEKLGEGSYGSVYKAIHKETGQIVAIKQVPV---ESDLQEIIKEISIMQQCDSPHVVK 87

  Fly    74 YYGSFLKGTKLWIIMEYLGGGSALDL--MKAGSFEEMHIGIILREVLKGLDYLHSERKLHRDIKA 136
            ||||:.|.|.|||:|||.|.||..|:  ::..:..|..|..||:..||||:|||..||:||||||
Mouse    88 YYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILQSTLKGLEYLHFMRKIHRDIKA 152

  Fly   137 ANVLLSEQGDVKLADFGVAGQLTNTTSKRNTFVGTPFWMAPEVIKQSQYDAKADIWSLGITAIEL 201
            .|:||:.:|..||||||||||||:|.:||||.:|||||||||||::..|:..||||||||||||:
Mouse   153 GNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEM 217

  Fly   202 AKGEPPNSELHPMRVLFLIPKNNPPQLTGS--YTKSFKDFVEACLNKDPENRPTAKELLKYPFIK 264
            |:|:||.:::||||.:|:||.|.||.....  ::.:|.|||:.||.|.||.|.||.:||::||:|
Mouse   218 AEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDNFMDFVKQCLVKSPEQRATATQLLQHPFVK 282

  Fly   265 KAKKNAYLIDLID-----RFKKW-----KVSKGDESETESENSDSDSDAKQGGSSQDEPWIMTVK 319
            .||..:.|.|||:     :.|:.     :|.:.||..:|.:..||.:..:..|   ||  :.||:
Mouse   283 SAKGVSILRDLINEAMDVKLKRQEAQQREVDQDDEENSEEDEMDSGTMVRAAG---DE--MGTVR 342

  Fly   320 GLHINSAPRAGVNSFQLQEHELTMQKLMQT 349
               :.|....|.|:  :.||..|:...:.|
Mouse   343 ---VASTMSGGANT--MIEHGDTLPSQLGT 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GckIIINP_650596.1 STKc_MST3_like 12..283 CDD:270786 144/284 (51%)
S_TKc 13..263 CDD:214567 135/253 (53%)
Stk4NP_067395.1 STKc_MST1_2 26..281 CDD:132943 137/257 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..334 6/28 (21%)
Mst1_SARAH 433..480 CDD:314497
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D967913at2759
OrthoFinder 1 1.000 - - FOG0000324
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.