DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GckIII and stk25

DIOPT Version :9

Sequence 1:NP_650596.1 Gene:GckIII / 42064 FlyBaseID:FBgn0266465 Length:642 Species:Drosophila melanogaster
Sequence 2:NP_001015684.1 Gene:stk25 / 548355 XenbaseID:XB-GENE-5860335 Length:400 Species:Xenopus tropicalis


Alignment Length:370 Identity:241/370 - (65%)
Similarity:289/370 - (78%) Gaps:23/370 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VDPELIFTKQERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIDDIQQEIMVLSQCDSPYV 71
            :|||.:|||.|||||||||||:|||:||:::||||||||||||||||:||||||.|||||||||:
 Frog     1 MDPERLFTKLERIGKGSFGEVYKGIENRSKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYI 65

  Fly    72 TKYYGSFLKGTKLWIIMEYLGGGSALDLMKAGSFEEMHIGIILREVLKGLDYLHSERKLHRDIKA 136
            |:||||:|||:|||||||||||||||||:|.|..||.:|..||||:||||||||||||:||||||
 Frog    66 TRYYGSYLKGSKLWIIMEYLGGGSALDLLKPGPLEEAYIATILREILKGLDYLHSERKIHRDIKA 130

  Fly   137 ANVLLSEQGDVKLADFGVAGQLTNTTSKRNTFVGTPFWMAPEVIKQSQYDAKADIWSLGITAIEL 201
            |||||||||||||||||||||||:|..||||||||||||||||||||.||.||||||||||||||
 Frog   131 ANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIEL 195

  Fly   202 AKGEPPNSELHPMRVLFLIPKNNPPQLTGSYTKSFKDFVEACLNKDPENRPTAKELLKYPFI-KK 265
            ||||||.|:||||||||||||||||.|.|.|:|.|||||||||||||.:||||:||||:.|| :.
 Frog   196 AKGEPPYSDLHPMRVLFLIPKNNPPSLQGQYSKPFKDFVEACLNKDPRSRPTARELLKHRFILRY 260

  Fly   266 AKKNAYLIDLIDRFKKWKVSKGDESETESENSDSDSDAKQGGSSQDEPWIMTVKGLHINSAPRAG 330
            .||.::|::|::|.|:|| |:|...::.|:.||.|::.:: ..:|...|          |.|.. 
 Frog   261 TKKTSFLVELVERHKRWK-SQGHREDSSSDESDMDNEDER-NQNQIPIW----------SFPET- 312

  Fly   331 VNSFQLQEHELTMQKLMQTTHSPAGGGGVQASPAANALSSSVSAV 375
            :.:..:...:...||..:..|         ..|.::.||:.|:.|
 Frog   313 ICAKSMSRMQWGCQKSAEVIH---------RLPRSHCLSALVTPV 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GckIIINP_650596.1 STKc_MST3_like 12..283 CDD:270786 218/271 (80%)
S_TKc 13..263 CDD:214567 210/249 (84%)
stk25NP_001015684.1 STKc_MST3_like 6..278 CDD:270786 218/271 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D418754at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R966
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.040

Return to query results.
Submit another query.