DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GckIII and mbt

DIOPT Version :9

Sequence 1:NP_650596.1 Gene:GckIII / 42064 FlyBaseID:FBgn0266465 Length:642 Species:Drosophila melanogaster
Sequence 2:NP_523375.2 Gene:mbt / 32631 FlyBaseID:FBgn0025743 Length:639 Species:Drosophila melanogaster


Alignment Length:271 Identity:101/271 - (37%)
Similarity:157/271 - (57%) Gaps:3/271 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DPELIFTKQERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIDDIQQEIMVLSQCDSPYVT 72
            ||........:||:||.|.|....|..|.:.||:|.:||.: :...:.:..|::::.....|.:.
  Fly   363 DPRENLDHFNKIGEGSTGTVCIATDKSTGRQVAVKKMDLRK-QQRRELLFNEVVIMRDYHHPNIV 426

  Fly    73 KYYGSFLKGTKLWIIMEYLGGGSALDLMKAGSFEEMHIGIILREVLKGLDYLHSERKLHRDIKAA 137
            :.|.|||...:||::||||.||:..|::.....:|..|..:.::.||.|.||||:..:|||||:.
  Fly   427 ETYSSFLVNDELWVVMEYLEGGALTDIVTHSRMDEEQIATVCKQCLKALAYLHSQGVIHRDIKSD 491

  Fly   138 NVLLSEQGDVKLADFGVAGQLTNTTSKRNTFVGTPFWMAPEVIKQSQYDAKADIWSLGITAIELA 202
            ::||:..|.|||:|||...|::....||.:.||||:||:||||.:..|..:.|||||||..||:.
  Fly   492 SILLAADGRVKLSDFGFCAQVSQELPKRKSLVGTPYWMSPEVISRLPYGPEVDIWSLGIMVIEMV 556

  Fly   203 KGEPPNSELHPMRVLFLIPKNNPPQLTGSYTKS--FKDFVEACLNKDPENRPTAKELLKYPFIKK 265
            .||||.....|::.:..|....||.|..::..|  .:.|::..|.:||..|.||.|||.:||:::
  Fly   557 DGEPPFFNEPPLQAMRRIRDMQPPNLKNAHKVSPRLQSFLDRMLVRDPAQRATAAELLAHPFLRQ 621

  Fly   266 AKKNAYLIDLI 276
            |...:.|:.|:
  Fly   622 AGPPSLLVPLM 632

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GckIIINP_650596.1 STKc_MST3_like 12..283 CDD:270786 99/267 (37%)
S_TKc 13..263 CDD:214567 95/251 (38%)
mbtNP_523375.2 CRIB_PAK_like 9..54 CDD:238526
STKc_PAK_II 360..620 CDD:270815 98/257 (38%)
S_TKc 372..619 CDD:214567 95/247 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438549
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.