DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GckIII and ppk2

DIOPT Version :9

Sequence 1:NP_650596.1 Gene:GckIII / 42064 FlyBaseID:FBgn0266465 Length:642 Species:Drosophila melanogaster
Sequence 2:NP_594646.1 Gene:ppk2 / 2543100 PomBaseID:SPAC12B10.14c Length:665 Species:Schizosaccharomyces pombe


Alignment Length:275 Identity:61/275 - (22%)
Similarity:119/275 - (43%) Gaps:28/275 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TEKVDPELIFT------KQERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDE---IDDIQQE 59
            |:| ||...:|      :|:.:|      .:.......::||.||..|:......   ::::|: 
pombe   380 TQK-DPLFFYTDFTKICQQDTVG------TYVARQTLDKEVVVIKRFDISAVTHRRLLLEELQR- 436

  Fly    60 IMVLSQCDSPYVTKYYGSFLKGTKLWIIMEYLGGGSALD-LMKAGSFEEMHIGIILREVLKGLDY 123
               ||......:.:|..||.....:|.:.||....:.|. |:....|.|::|..|..|:..||.:
pombe   437 ---LSGLSHKNLIRYNESFWYLNNIWSVFEYKDPSTKLSALIPKYFFSELNIASICYEISSGLAF 498

  Fly   124 LHSERKLHRDIKAANVLLSEQGDVKLADFGVAGQLTNTTSKRNTFVGTPFWMAPEVIKQSQYDAK 188
            ||:....|.::....:.|::...:|:.::..:.......:.|......|.|:..:..|:.   ..
pombe   499 LHNSGIAHHNLTTECIYLTKSSCLKIGNYAFSSPYIERQTNRGAVSHVPDWLIEKNYKEG---FM 560

  Fly   189 ADIWSLGITAIELAKGEPPNSELHPMRVLFLIPKNN--PPQLTGSYTKSFKDFVEACLNKDPENR 251
            .|:.|||:.|:|:.:|: ||.....::.:.|.|..|  ..::.|..::.||:|:...|..:....
pombe   561 KDVKSLGLVALEIFQGQ-PNFFRKSIQSIQLTPNANVLVNRVRGLISQEFKEFLLQTLQAETLQG 624

  Fly   252 PTAKELLK-YPFIKK 265
            |....||: ..|::|
pombe   625 PNINMLLETSSFLEK 639

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GckIIINP_650596.1 STKc_MST3_like 12..283 CDD:270786 57/267 (21%)
S_TKc 13..263 CDD:214567 55/262 (21%)
ppk2NP_594646.1 DUF863 59..>320 CDD:283539
PKc_like 387..638 CDD:304357 56/264 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48012
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.