DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GckIII and MAP3K8

DIOPT Version :9

Sequence 1:NP_650596.1 Gene:GckIII / 42064 FlyBaseID:FBgn0266465 Length:642 Species:Drosophila melanogaster
Sequence 2:NP_001231063.1 Gene:MAP3K8 / 1326 HGNCID:6860 Length:467 Species:Homo sapiens


Alignment Length:324 Identity:97/324 - (29%)
Similarity:166/324 - (51%) Gaps:26/324 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIDDIQQEIMVLSQCDSPYVTKYYGSFLKGTK 83
            |.:|:||:|:...|.:|::.:|.|:|.:    |:......||....:.::  :.:.||:.|.|..
Human   144 IPRGAFGKVYLAQDIKTKKRMACKLIPV----DQFKPSDVEIQACFRHEN--IAELYGAVLWGET 202

  Fly    84 LWIIMEYLGGGSALD-LMKAGSFEEMHIGIILREVLKGLDYLHSERKLHRDIKAANVLLSEQGDV 147
            :.:.||...|||.|: |...|...|..|..:.:.||||||:|||::.:|.|||.:|::......|
Human   203 VHLFMEAGEGGSVLEKLESCGPMREFEIIWVTKHVLKGLDFLHSKKVIHHDIKPSNIVFMSTKAV 267

  Fly   148 KLADFGVAGQLTNTTSKRNTFVGTPFWMAPEVIKQSQYDAKADIWSLGITAIELAKGEPPNSELH 212
             |.|||::.|:|..........||..:|:||||....:..||||:|||.|.|.:..|.||..:.:
Human   268 -LVDFGLSVQMTEDVYFPKDLRGTEIYMSPEVILCRGHSTKADIYSLGATLIHMQTGTPPWVKRY 331

  Fly   213 PMRV----LFLIPKNNPP--QLTGSYTKSFKDFVEACLNKDPENRPTAKELLKYPFIKKAKKN-- 269
            |...    |::|.|..||  .:....:...::.:||.|.::|.:||.|.:|||:..:...:::  
Human   332 PRSAYPSYLYIIHKQAPPLEDIADDCSPGMRELIEASLERNPNHRPRAADLLKHEALNPPREDQP 396

  Fly   270 -AYLID--LIDRFKKWKVSKGDESETESENSDSDSDAKQGGSSQDEPWIMTVKGLHINSAPRAG 330
             ...:|  |::|       |...|..|.|..::.:|:...||:::...:...:.|:|:....||
Human   397 RCQSLDSALLER-------KRLLSRKELELPENIADSSCTGSTEESEMLKRQRSLYIDLGALAG 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GckIIINP_650596.1 STKc_MST3_like 12..283 CDD:270786 86/275 (31%)
S_TKc 13..263 CDD:214567 83/250 (33%)
MAP3K8NP_001231063.1 STKc_MAP3K8 133..388 CDD:270897 83/250 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.