DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Keap1 and AT4G39590

DIOPT Version :10

Sequence 1:NP_732202.2 Gene:Keap1 / 42062 FlyBaseID:FBgn0038475 Length:776 Species:Drosophila melanogaster
Sequence 2:NP_568062.1 Gene:AT4G39590 / 830113 AraportID:AT4G39590 Length:402 Species:Arabidopsis thaliana


Alignment Length:160 Identity:36/160 - (22%)
Similarity:65/160 - (40%) Gaps:32/160 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   462 PMHAKRLGVGVVVVNRLLYAIGGFDGNE------------RLASVECYHPENNEWSFLPPLQTGR 514
            |.:...|...:|.|...:|.|||..|::            :::.::|   .::.|...|.::..|
plant   127 PQYPLTLSSNLVAVGSNIYRIGGTVGDDSCPLGFDREPSSKVSILDC---RSHTWRDGPRMRLNR 188

  Fly   515 SGAGVAAINQYIYVVGGFDGTRQLA-TVERYDTENDTWDMVAPIQIA--------RSALSLTPLD 570
            ..:..:.::..|||.||.:.|...: .:|.:|.:..:|..|....|.        |.|:.....|
plant   189 RSSTTSVVDGKIYVTGGTEDTDNPSHWIEVFDPKTQSWGTVTNPHIVKVWEEVCYRRAVKSIGHD 253

  Fly   571 EKLYAIGGFDGNNFLSIVEVYDPRTNTWTT 600
            .|||    ..|:.::    ||||....|.:
plant   254 GKLY----LSGDKYV----VYDPDEGKWNS 275

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Keap1NP_732202.2 PHA03098 92..599 CDD:222983 35/157 (22%)
KELCH repeat 369..416 CDD:276965