DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Keap1 and AT4G23580

DIOPT Version :10

Sequence 1:NP_732202.2 Gene:Keap1 / 42062 FlyBaseID:FBgn0038475 Length:776 Species:Drosophila melanogaster
Sequence 2:NP_194089.1 Gene:AT4G23580 / 828458 AraportID:AT4G23580 Length:383 Species:Arabidopsis thaliana


Alignment Length:165 Identity:42/165 - (25%)
Similarity:68/165 - (41%) Gaps:45/165 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   451 DPDLDRWTLV--QPMHAKRLGV-------------GVVVVNRLLYAIGGFDGNER---------- 490
            |.:|..|.::  :|..:|.:.|             |||||...:|||||...|:.          
plant    78 DSELLHWFILCHRPHSSKNVLVPISSPSFTSPSLPGVVVVGPDVYAIGGGSKNKNVSIYATGSKT 142

  Fly   491 ---LASVECYHPENNEWSFLPPLQTGRSGAGVAAINQYIYVVGGFDGTRQLATVERYDTENDTWD 552
               |:||...:..::.|...|.::.||.......::..|||.||.|....:..:|.:||:..||:
plant   143 YNALSSVMIMNSRSHTWHEAPSMRVGRVFPSACTLDGRIYVTGGCDNLDTMNWMEIFDTKTQTWE 207

  Fly   553 MVAPIQIARSALSLTPLDEKLYAIGGFDGNNFLSI 587
            .   :||        |.:|..      .|:.:||:
plant   208 F---LQI--------PSEEIC------KGSEYLSV 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Keap1NP_732202.2 PHA03098 92..599 CDD:222983 42/165 (25%)
KELCH repeat 369..416 CDD:276965
KELCH repeat 420..463 CDD:276965 3/13 (23%)
KELCH repeat 467..510 CDD:276965 17/68 (25%)
KELCH repeat 514..558 CDD:276965 12/43 (28%)
KELCH repeat 561..606 CDD:276965 5/27 (19%)
AT4G23580NP_194089.1 F-box_AtAFR-like 15..59 CDD:438923
PHA03098 <122..299 CDD:222983 31/121 (26%)
NanM <122..>207 CDD:442289 23/84 (27%)
KELCH repeat 169..209 CDD:276965 12/42 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.