DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Keap1 and AT3G59940

DIOPT Version :10

Sequence 1:NP_732202.2 Gene:Keap1 / 42062 FlyBaseID:FBgn0038475 Length:776 Species:Drosophila melanogaster
Sequence 2:NP_191553.1 Gene:AT3G59940 / 825164 AraportID:AT3G59940 Length:418 Species:Arabidopsis thaliana


Alignment Length:273 Identity:69/273 - (25%)
Similarity:90/273 - (32%) Gaps:101/273 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   403 YSAVTETW-RPCAPMSVPRHRVGVAVMDE-LMYAVGGSAGMEYHNTVEYYDPD----------LD 455
            |:|..:|| |...|..:|.....||:.|. .:..:||            :||:          ||
plant   123 YNATLDTWHRVAIPERIPLFCECVAIQDAGKVLLIGG------------WDPETLQPVRDVFVLD 175

  Fly   456 ---------RWTLVQPMHAKR-----LGVGVVVVNRLLYAIGGFDGNER-LASVECYHPENNEWS 505
                     |:...:||.|.|     ..||...|    |..||.|..:. |.|.|.|..|.:|||
plant   176 FFAGEGSGRRFRRGRPMSAARSFFACASVGSTKV----YVAGGHDDQKNALRSAEVYDVEKDEWS 236

  Fly   506 FLPPLQTGRS---GAGVAAINQYIYVVGGFDGTRQLATVERYDTENDTWDMVAPIQIARSALSLT 567
            .|||:..||.   |..:|....:..:.|             |.||..                  
plant   237 MLPPMTEGRDECHGFSMATDPGFCVLSG-------------YGTETQ------------------ 270

  Fly   568 PLDEKLYAIGGFDGNNFLSIVEVYDPRTNTWTT-----GTPLKSGRSGHASAVIYQP----ACST 623
                          ..|.|..|:|||.||:|:|     ..|..|.|...|:|....|    .|..
plant   271 --------------GQFRSDGEIYDPITNSWSTIENVWPFPDLSPRGRTAAAAAEFPGDFRGCRL 321

  Fly   624 -TFMDYEDSDAPH 635
             .|:|.|....||
plant   322 WCFIDSERQSQPH 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Keap1NP_732202.2 PHA03098 92..599 CDD:222983 55/225 (24%)
KELCH repeat 369..416 CDD:276965 5/13 (38%)
KELCH repeat 420..463 CDD:276965 10/62 (16%)
KELCH repeat 467..510 CDD:276965 18/48 (38%)
KELCH repeat 514..558 CDD:276965 7/46 (15%)
KELCH repeat 561..606 CDD:276965 11/49 (22%)
AT3G59940NP_191553.1 F-box_AtAFR-like 15..59 CDD:438923
NanM 144..>315 CDD:442289 56/231 (24%)
KELCH repeat 196..242 CDD:276965 19/49 (39%)
KELCH repeat 245..292 CDD:276965 17/91 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.