DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Keap1 and KLHL7

DIOPT Version :9

Sequence 1:NP_732202.2 Gene:Keap1 / 42062 FlyBaseID:FBgn0038475 Length:776 Species:Drosophila melanogaster
Sequence 2:XP_006715816.1 Gene:KLHL7 / 55975 HGNCID:15646 Length:599 Species:Homo sapiens


Alignment Length:586 Identity:174/586 - (29%)
Similarity:266/586 - (45%) Gaps:87/586 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 AKEALKM-------MYMMRSHGMLTDVVLEVKKELFPAHKVVLSAASPYFKAMFTGGLKESEMSR 130
            |:|..|:       |..||....|.||:|.|::...|||:|||:|||.:|..|||..:.||:...
Human    20 AREEAKLLAGFMGVMNNMRKQKTLCDVILMVQERKIPAHRVVLAAASHFFNLMFTTNMLESKSFE 84

  Fly   131 VQLQGVCPTAMSRILYFMYTGQIRVTEVTVCQLLPAATMFQVPNVIDACCAFLERQLDPTNAI-- 193
            |:|:...|..:.:::.|.||.:|.|....|..||.||..:|:..|...|..||:.|:|.:|.:  
Human    85 VELKDAEPDIIEQLVEFAYTARISVNSNNVQSLLDAANQYQIEPVKKMCVDFLKEQVDASNCLGE 149

  Fly   194 -----------GIAHFAEQHGCVELQKKANVFIERNFTQVCQEEEFLQLSAYQLIALIRRDELNV 247
                       ||:..||...|.||:..|:.||.::||:|.:.:|||||...::..|:.:|.|.|
Human   150 AEKVDQSLPECGISVLAECLDCPELKATADDFIHQHFTEVYKTDEFLQLDVKRVTHLLNQDTLTV 214

  Fly   248 QEEREVYNAVLKWVKYDEDNRHCKMEHILGAVRCQFLTPNFLKEQMKNCDVLRKVPAC------- 305
            :.|.:||:|.::|:||||.||...|..||..||...::.|||.:.::...:::..|.|       
Human   215 RAEDQVYDAAVRWLKYDEPNRQPFMVDILAKVRFPLISKNFLSKTVQAEPLIQDNPECLKMVISG 279

  Fly   306 ------------------------REYLAKIF-------------KDL--TLHKCPGVKERTPNT 331
                                    .:|...:|             ||.  |..:||..|.|....
Human   280 MRYHLLSPEDREELVDGTRPRRKKHDYRIALFGGSQPQSCRYFNPKDYSWTDIRCPFEKRRDAAC 344

  Fly   332 T---RMIFVAGGFFRHSLDILEAYNVDDMTWTTLANLRIPRSGLGAAFLKGKFYAVGGRNNNIGS 393
            .   .::::.||.....:..::.|||...:|.:......||..|.|...:||.|..||  :.:|:
Human   345 VFWDNVVYILGGSQLFPIKRMDCYNVVKDSWYSKLGPPTPRDSLAACAAEGKIYTSGG--SEVGN 407

  Fly   394 S--YDSDWVDRYSAVTETWRPCAPMSVPRHRVGVAVMDELMYAVGGSAGMEYH----NTVEYYDP 452
            |  |   ..:.|...||:|.....|...|...|:...:.|:|..|||.|....    |:.|.|||
Human   408 SALY---LFECYDTRTESWHTKPSMLTQRCSHGMVEANGLIYVCGGSLGNNVSGRVLNSCEVYDP 469

  Fly   453 DLDRWTLVQPMHAKRLGVGVVVVNRLLYAIGGFDGNERLASVECYHPENNEWSFLPPLQTGRSGA 517
            ..:.||.:.||...|...|:|.|...::|:||.:|...|.:||.|..:.|||..:.|:.......
Human   470 ATETWTELCPMIEARKNHGLVFVKDKIFAVGGQNGLGGLDNVEYYDIKLNEWKMVSPMPWKGVTV 534

  Fly   518 GVAAINQYIYVVGGFDGTRQLATVERYDTENDTWDMVAPIQIARSALSLTPLDEKLYAIGGFDGN 582
            ..||:...:||:.||.|..:|..:..|:||.|.|       :|.|.:...|:...|..:....|.
Human   535 KCAAVGSIVYVLAGFQGVGRLGHILEYNTETDKW-------VANSKVRAFPVTSCLICVVDTCGA 592

  Fly   583 N 583
            |
Human   593 N 593

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Keap1NP_732202.2 BTB 80..183 CDD:279045 39/102 (38%)
PHA03098 92..599 CDD:222983 166/560 (30%)
BACK 192..294 CDD:285009 41/114 (36%)
Kelch 335..379 CDD:128874 10/43 (23%)
KELCH repeat 369..416 CDD:276965 15/48 (31%)
Kelch 382..430 CDD:128874 13/49 (27%)
KELCH repeat 420..463 CDD:276965 15/46 (33%)
Kelch 433..476 CDD:128874 17/46 (37%)
KELCH repeat 467..510 CDD:276965 15/42 (36%)
Kelch 478..523 CDD:128874 14/44 (32%)
KELCH repeat 514..558 CDD:276965 13/43 (30%)
Kelch_1 514..556 CDD:279660 13/41 (32%)
KELCH repeat 561..606 CDD:276965 5/23 (22%)
Kelch 572..616 CDD:128874 3/12 (25%)
KLHL7XP_006715816.1 BTB_POZ_KLHL7 23..148 CDD:349546 45/124 (36%)
PHA03098 37..568 CDD:222983 163/535 (30%)
BACK 140..250 CDD:391941 41/109 (38%)
KELCH repeat 385..429 CDD:276965 15/48 (31%)
KELCH repeat 433..481 CDD:276965 16/47 (34%)
KELCH repeat 484..528 CDD:276965 16/43 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4441
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D312716at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.