DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Keap1 and CG12692

DIOPT Version :10

Sequence 1:NP_732202.2 Gene:Keap1 / 42062 FlyBaseID:FBgn0038475 Length:776 Species:Drosophila melanogaster
Sequence 2:NP_572159.1 Gene:CG12692 / 31372 FlyBaseID:FBgn0029703 Length:553 Species:Drosophila melanogaster


Alignment Length:104 Identity:26/104 - (25%)
Similarity:48/104 - (46%) Gaps:13/104 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 ELQKKANVFIERNFTQVCQEEEFLQLSAYQLIALIRRDELNVQEEREVYNAVLKWVKYDEDNRHC 270
            ||:|.....|...|..|...::|.::....:|.::::|.|.|..|.||..|:::|:       :|
  Fly   177 ELRKLMLQRIGAAFLAVLGGDDFQRMPLEDVITMLQQDSLGVNSEMEVLVAIIRWL-------NC 234

  Fly   271 KMEHILGA----VRCQFLT--PNFLKEQMKNCDVLRKVP 303
            :.:.|..|    :.|..||  |..:.::...|.:...||
  Fly   235 QSKCIDQATPLLMDCLRLTLLPLPILKRFWRCAMAPPVP 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Keap1NP_732202.2 PHA03098 92..599 CDD:222983 26/104 (25%)
KELCH repeat 369..416 CDD:276965
KELCH repeat 420..463 CDD:276965
KELCH repeat 467..510 CDD:276965
KELCH repeat 514..558 CDD:276965
KELCH repeat 561..606 CDD:276965
CG12692NP_572159.1 BACK 162..265 CDD:462237 23/94 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.