| Sequence 1: | NP_732202.2 | Gene: | Keap1 / 42062 | FlyBaseID: | FBgn0038475 | Length: | 776 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_017212974.2 | Gene: | LOC108178999 / 108178999 | -ID: | - | Length: | 268 | Species: | Danio rerio |
| Alignment Length: | 252 | Identity: | 92/252 - (36%) |
|---|---|---|---|
| Similarity: | 135/252 - (53%) | Gaps: | 15/252 - (5%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 364 NLRIPRSGLGAAFLKGKFYAVGGRNNNIGSSYDS-------DWVDRYSAVTETWRPCAPMSVPRH 421
Fly 422 RVGVAVMDELMYAVGGSAGMEYHNTVEYYDPDLDRWTLVQPMHAKRLGVGVVVVNRLLYAIGGFD 486
Fly 487 GNERLASVECYHPENNEWSFLPPLQTGRSGAGVAAINQYIYVVGGFDGTRQLATVERYDTENDTW 551
Fly 552 DMVAPIQIARSALSLTPLDEKLYAIGGFDGNNFLSIVEVYDPRTNTWTTGTPLKSGR 608 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Keap1 | NP_732202.2 | BTB | 80..183 | CDD:279045 | |
| PHA03098 | 92..599 | CDD:222983 | 89/241 (37%) | ||
| BACK | 192..294 | CDD:285009 | |||
| Kelch | 335..379 | CDD:128874 | 3/14 (21%) | ||
| KELCH repeat | 369..416 | CDD:276965 | 10/53 (19%) | ||
| Kelch | 382..430 | CDD:128874 | 12/54 (22%) | ||
| KELCH repeat | 420..463 | CDD:276965 | 13/42 (31%) | ||
| Kelch | 433..476 | CDD:128874 | 17/42 (40%) | ||
| KELCH repeat | 467..510 | CDD:276965 | 18/42 (43%) | ||
| Kelch | 478..523 | CDD:128874 | 21/44 (48%) | ||
| KELCH repeat | 514..558 | CDD:276965 | 26/43 (60%) | ||
| Kelch_1 | 514..556 | CDD:279660 | 25/41 (61%) | ||
| KELCH repeat | 561..606 | CDD:276965 | 19/44 (43%) | ||
| Kelch | 572..616 | CDD:128874 | 17/37 (46%) | ||
| LOC108178999 | XP_017212974.2 | BTB | <4..205 | CDD:333434 | 71/198 (36%) |
| KELCH repeat | 19..65 | CDD:276965 | 10/53 (19%) | ||
| KELCH repeat | 69..112 | CDD:276965 | 13/42 (31%) | ||
| KELCH repeat | 116..159 | CDD:276965 | 18/42 (43%) | ||
| KELCH repeat | 163..207 | CDD:276965 | 26/43 (60%) | ||
| KELCH repeat | 210..255 | CDD:276965 | 19/44 (43%) | ||
| Kelch | 221..265 | CDD:128874 | 17/37 (46%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D312716at33208 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X9 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.920 | |||||