DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS11 and MRPS18

DIOPT Version :9

Sequence 1:NP_524382.1 Gene:mRpS11 / 42061 FlyBaseID:FBgn0038474 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_014093.1 Gene:MRPS18 / 855410 SGDID:S000005250 Length:217 Species:Saccharomyces cerevisiae


Alignment Length:113 Identity:31/113 - (27%)
Similarity:50/113 - (44%) Gaps:15/113 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 NNTIISVTDHKGVLRLIRSCGIEGFKNTRKGTNIAAQATAVTISGKAIELGW------KTVRVKV 157
            |:|::...:....:::..|.|..||:...:|...||..|    ||:..||..      |.:.|.:
Yeast   109 NDTMLYYLNLPQKVKISLSTGCLGFRKAARGEYEAAFQT----SGRMFELIKEKNMLNKDIEVVM 169

  Fly   158 RGLGPGR---MSAIKGLQMGGL--NIVSITDNTHVSFNPPRPRKQRSL 200
            ...|.||   :||:.|.:...:  .:|.|:|.|.:.|...|..|.|.|
Yeast   170 DDFGKGRAAFISALVGKEGASVVKKVVKISDATKLKFGGVRSPKMRRL 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS11NP_524382.1 Ribosomal_S11 91..198 CDD:294237 29/109 (27%)
MRPS18NP_014093.1 Ribosomal_S11 107..215 CDD:320911 29/109 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0100
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11759
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.