DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS11 and RPS14B

DIOPT Version :9

Sequence 1:NP_524382.1 Gene:mRpS11 / 42061 FlyBaseID:FBgn0038474 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_012344.1 Gene:RPS14B / 853248 SGDID:S000003727 Length:138 Species:Saccharomyces cerevisiae


Alignment Length:117 Identity:36/117 - (30%)
Similarity:51/117 - (43%) Gaps:9/117 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 ICNIRVSPNNTIISVTDHKGVLRLIRSCGIEGFKNTR-KGTNIAAQATAVTISGKAIELGWKTVR 154
            :..|..|.|:|.:.|||..|...:.|..|....|..| :.:..||...|..::.|..|:|...|.
Yeast    17 VARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVH 81

  Fly   155 VKVRGL--------GPGRMSAIKGLQMGGLNIVSITDNTHVSFNPPRPRKQR 198
            ||:|..        |||..:|::.|...||.|..|.|.|.|..:..|.:..|
Yeast    82 VKIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGR 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS11NP_524382.1 Ribosomal_S11 91..198 CDD:294237 35/115 (30%)
RPS14BNP_012344.1 PTZ00129 7..127 CDD:185465 34/109 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0100
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100266
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.