DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS11 and rps11

DIOPT Version :10

Sequence 1:NP_524382.1 Gene:mRpS11 / 42061 FlyBaseID:FBgn0038474 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_051091.1 Gene:rps11 / 844726 -ID:- Length:138 Species:Arabidopsis thaliana


Alignment Length:108 Identity:36/108 - (33%)
Similarity:62/108 - (57%) Gaps:0/108 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 ICNIRVSPNNTIISVTDHKGVLRLIRSCGIEGFKNTRKGTNIAAQATAVTISGKAIELGWKTVRV 155
            :.:::.|.||||::|||.:|.:....|.|..||:.||:||..|||..|.......::.|.:...|
plant    29 VIHVQASFNNTIVTVTDVRGRVISWSSAGTCGFRGTRRGTPFAAQTAAGNAIRAVVDQGMQRAEV 93

  Fly   156 KVRGLGPGRMSAIKGLQMGGLNIVSITDNTHVSFNPPRPRKQR 198
            :::|.|.||.:|::.::..|:.:..:.|.|.:..|..||.|:|
plant    94 RIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGCRPPKKR 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS11NP_524382.1 RpsK 91..198 CDD:439870 35/106 (33%)
rps11NP_051091.1 rps11 15..130 CDD:176982 32/100 (32%)

Return to query results.
Submit another query.