DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS11 and NFD3

DIOPT Version :9

Sequence 1:NP_524382.1 Gene:mRpS11 / 42061 FlyBaseID:FBgn0038474 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_564385.1 Gene:NFD3 / 840071 AraportID:AT1G31817 Length:314 Species:Arabidopsis thaliana


Alignment Length:222 Identity:68/222 - (30%)
Similarity:93/222 - (41%) Gaps:39/222 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FLSALRS-----------ITMPAVPLQTSRIHTSACWRKAEDRKEMLASLPAKDEGTVGEKTVDI 60
            |.|:|||           .|.|.:| .|.....||....:.:.....:|| .|:....|.|:.|:
plant   101 FKSSLRSRLPNSLPDQFGQTNPGLP-NTGGSGFSAPSLSSYENFTQSSSL-LKENSRSGGKSSDL 163

  Fly    61 DTLI-------NRKAKFFPDASTANTLFNGIPFNELPICNIRVSPNNTIISVTDHKGVLRLIRSC 118
            |.:.       .|.|..|......|...|.      .|.:|::..|||.::|||.||.::...:.
plant   164 DFVREVIEDEGRRTAGIFSHFQRPNLETNA------DIIHIKMLRNNTFVTVTDSKGNVKCKATS 222

  Fly   119 G-IEGFKNTRKGTNIAAQATAVTISGKAIELGWKTVRVKVRG---LGPGRMSAIKGLQMGGLN-- 177
            | :...|..||.||..|.|||..|..:|..:|.|:|.|||.|   .|. :..||...:.|..|  
plant   223 GSLPDLKGGRKMTNYTADATAENIGRRAKAMGLKSVVVKVNGFTHFGK-KKKAIIAFRDGFTNSR 286

  Fly   178 -----IVSITDNTHVSFNPPR-PRKQR 198
                 ||.|.|.|..:.|..| |||:|
plant   287 SDQNPIVYIEDTTRKAHNGCRLPRKRR 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS11NP_524382.1 Ribosomal_S11 91..198 CDD:294237 44/118 (37%)
NFD3NP_564385.1 Ribosomal_S11 195..314 CDD:294237 45/120 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0100
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1303296at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11759
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.