DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS11 and Mrps11

DIOPT Version :9

Sequence 1:NP_524382.1 Gene:mRpS11 / 42061 FlyBaseID:FBgn0038474 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_080774.2 Gene:Mrps11 / 67994 MGIID:1915244 Length:191 Species:Mus musculus


Alignment Length:164 Identity:66/164 - (40%)
Similarity:92/164 - (56%) Gaps:9/164 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PAKD--------EGTVGEKTVDIDTLINRKAKFFPDASTANTL-FNGIPFNELPICNIRVSPNNT 101
            |||:        |.:...:..:.:...:|.:.:.|.....::| :.|:.|.::||.:|:.:.|||
Mouse    28 PAKNIHTGAPRLEDSAARQNTEREAAPSRFSLYPPVPGQESSLQWAGMKFEDVPIAHIKATYNNT 92

  Fly   102 IISVTDHKGVLRLIRSCGIEGFKNTRKGTNIAAQATAVTISGKAIELGWKTVRVKVRGLGPGRMS 166
            .|.|...........|||.|||:|.:|||.||||...:..:.||...|...:||.|:|:||||.|
Mouse    93 QIQVVSATNASLARASCGTEGFRNAKKGTGIAAQTAGIAAAAKATGKGVTHIRVVVKGMGPGRWS 157

  Fly   167 AIKGLQMGGLNIVSITDNTHVSFNPPRPRKQRSL 200
            |||||.||||.::||||||.|..|..||||.|.|
Mouse   158 AIKGLTMGGLEVISITDNTPVPHNGCRPRKARRL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS11NP_524382.1 Ribosomal_S11 91..198 CDD:294237 54/106 (51%)
Mrps11NP_080774.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..62 2/24 (8%)
Ribosomal_S11 82..190 CDD:294237 54/107 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833402
Domainoid 1 1.000 105 1.000 Domainoid score I6658
eggNOG 1 0.900 - - E1_COG0100
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 115 1.000 Inparanoid score I4818
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004727
OrthoInspector 1 1.000 - - oto95305
orthoMCL 1 0.900 - - OOG6_100266
Panther 1 1.100 - - LDO PTHR11759
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3942
SonicParanoid 1 1.000 - - X3323
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.780

Return to query results.
Submit another query.