DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS11 and MRPS11

DIOPT Version :9

Sequence 1:NP_524382.1 Gene:mRpS11 / 42061 FlyBaseID:FBgn0038474 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_073750.2 Gene:MRPS11 / 64963 HGNCID:14050 Length:194 Species:Homo sapiens


Alignment Length:202 Identity:77/202 - (38%)
Similarity:106/202 - (52%) Gaps:25/202 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 MPAVPLQTSRIHTSACWRKAEDRKEMLASLPAKDEGTV--GEKTVDIDTLINRKAKFFPDASTAN 78
            |.||....||...|..|.:...|  ::|..||   ||:  |.:.:. |....:|.:  .:|:.::
Human     1 MQAVRNAGSRFLRSWTWPQTAGR--VVARTPA---GTICTGARQLQ-DAAAKQKVE--QNAAPSH 57

  Fly    79 TLFN---------------GIPFNELPICNIRVSPNNTIISVTDHKGVLRLIRSCGIEGFKNTRK 128
            |.|:               |..|.|:||.:|:.|.|||.|.|...........|||.|||:|.:|
Human    58 TKFSIYPPIPGEESSLRWAGKKFEEIPIAHIKASHNNTQIQVVSASNEPLAFASCGTEGFRNAKK 122

  Fly   129 GTNIAAQATAVTISGKAIELGWKTVRVKVRGLGPGRMSAIKGLQMGGLNIVSITDNTHVSFNPPR 193
            ||.||||...:..:.:|.:.|...:||.|:||||||:||:.||.||||.::||||||.:..|..|
Human   123 GTGIAAQTAGIAAAARAKQKGVIHIRVVVKGLGPGRLSAMHGLIMGGLEVISITDNTPIPHNGCR 187

  Fly   194 PRKQRSL 200
            |||.|.|
Human   188 PRKARKL 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS11NP_524382.1 Ribosomal_S11 91..198 CDD:294237 52/106 (49%)
MRPS11NP_073750.2 PRK02812 <30..104 CDD:235072 21/79 (27%)
Ribosomal_S11 85..193 CDD:320911 52/107 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143225
Domainoid 1 1.000 103 1.000 Domainoid score I6800
eggNOG 1 0.900 - - E1_COG0100
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4853
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1303296at2759
OrthoFinder 1 1.000 - - FOG0004727
OrthoInspector 1 1.000 - - oto91723
orthoMCL 1 0.900 - - OOG6_100266
Panther 1 1.100 - - LDO PTHR11759
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3942
SonicParanoid 1 1.000 - - X3323
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.