DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS11 and mrps11

DIOPT Version :9

Sequence 1:NP_524382.1 Gene:mRpS11 / 42061 FlyBaseID:FBgn0038474 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001038262.1 Gene:mrps11 / 556272 ZFINID:ZDB-GENE-040724-84 Length:199 Species:Danio rerio


Alignment Length:191 Identity:76/191 - (39%)
Similarity:96/191 - (50%) Gaps:28/191 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RSITMPAVPLQTSRIHTSACWRKAEDRKEMLASLPAKDEGTVGEKTVDIDTLINRKAKFFP--DA 74
            |.:...||.||.|            |.|.:....|::.              :.|....||  ..
Zfish    35 RPLLCSAVRLQES------------DAKPVETQSPSEP--------------VRRLKDLFPPFPG 73

  Fly    75 STANTLFNGIPFNELPICNIRVSPNNTIISVTDHKGVLRLIRSCGIEGFKNTRKGTNIAAQATAV 139
            ..:...::...|.||||.:::.:.|||.|.|||..|...:..|||.|||||.:|.|.||||...:
Zfish    74 EDSPLRWDSKKFEELPIAHVKATYNNTHIQVTDCAGQYMVRTSCGTEGFKNVKKSTPIAAQTAGI 138

  Fly   140 TISGKAIELGWKTVRVKVRGLGPGRMSAIKGLQMGGLNIVSITDNTHVSFNPPRPRKQRSL 200
            :.:.||...|...|||.|:||||||.||||||.||||.:|||||||.|..|..||||.|.:
Zfish   139 SAAAKARAKGVTYVRVLVKGLGPGRFSAIKGLTMGGLEVVSITDNTPVPHNGCRPRKARRM 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS11NP_524382.1 Ribosomal_S11 91..198 CDD:294237 59/106 (56%)
mrps11NP_001038262.1 Ribosomal_S11 83..198 CDD:294237 63/114 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576071
Domainoid 1 1.000 69 1.000 Domainoid score I9626
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1303296at2759
OrthoFinder 1 1.000 - - FOG0004727
OrthoInspector 1 1.000 - - oto41229
orthoMCL 1 0.900 - - OOG6_100266
Panther 1 1.100 - - LDO PTHR11759
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3942
SonicParanoid 1 1.000 - - X3323
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.880

Return to query results.
Submit another query.