DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS11 and Mrps11

DIOPT Version :9

Sequence 1:NP_524382.1 Gene:mRpS11 / 42061 FlyBaseID:FBgn0038474 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001102618.1 Gene:Mrps11 / 499185 RGDID:1559901 Length:191 Species:Rattus norvegicus


Alignment Length:169 Identity:68/169 - (40%)
Similarity:94/169 - (55%) Gaps:9/169 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 MLASLPAKD--------EGTVGEKTVDIDTLINRKAKFFPDASTANTL-FNGIPFNELPICNIRV 96
            ::|..|||.        |.:...:..:.:...:|.:.:.|.....::| :.|:.|.|:||.:|:.
  Rat    23 LVAITPAKSIHTGAPRLEDSAARQNTEKEAAPSRFSIYPPVPGQESSLQWAGMKFEEVPIAHIKA 87

  Fly    97 SPNNTIISVTDHKGVLRLIRSCGIEGFKNTRKGTNIAAQATAVTISGKAIELGWKTVRVKVRGLG 161
            :.|||.|.|...........|||.|||:|.:|||.||||...:..:.||...|...:||.|:|:|
  Rat    88 TYNNTQIQVVSATNTSLARASCGTEGFRNAKKGTGIAAQTAGIAAAAKATGKGVTHIRVVVKGIG 152

  Fly   162 PGRMSAIKGLQMGGLNIVSITDNTHVSFNPPRPRKQRSL 200
            |||.||||||.||||.::||||||.|..|..||||.|.|
  Rat   153 PGRWSAIKGLTMGGLEVISITDNTPVPHNGCRPRKARRL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS11NP_524382.1 Ribosomal_S11 91..198 CDD:294237 54/106 (51%)
Mrps11NP_001102618.1 Ribosomal_S11 82..190 CDD:320911 54/107 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336957
Domainoid 1 1.000 105 1.000 Domainoid score I6513
eggNOG 1 0.900 - - E1_COG0100
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 116 1.000 Inparanoid score I4720
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1303296at2759
OrthoFinder 1 1.000 - - FOG0004727
OrthoInspector 1 1.000 - - otm46396
orthoMCL 1 0.900 - - OOG6_100266
Panther 1 1.100 - - LDO PTHR11759
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3323
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.760

Return to query results.
Submit another query.