DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS11 and mrps18

DIOPT Version :9

Sequence 1:NP_524382.1 Gene:mRpS11 / 42061 FlyBaseID:FBgn0038474 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_594803.1 Gene:mrps18 / 2542616 PomBaseID:SPAC1B3.18c Length:223 Species:Schizosaccharomyces pombe


Alignment Length:227 Identity:52/227 - (22%)
Similarity:90/227 - (39%) Gaps:49/227 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SLKSVFLSAL------RSIT-----MPAVPLQTSRIHTSACWRKAEDR---KEMLASLPAKDEGT 52
            :..|:|.|:|      :|:.     :..:.|..:::.....|.::..|   |:.|:||       
pombe    18 TFSSIFFSSLILFLVYKSVLSKLFFIKYLMLNLTKVGLRRFWSQSPRRNAPKKELSSL------- 75

  Fly    53 VGEKTVDIDTLINRKAKFFPDASTANTLFNGIPFNELPI-CNIRVSPNNTIISVTDHKGVLRLIR 116
                   :::.|..|| |.......|.:..|.....:|. .:.:...|||.|::...:..:....
pombe    76 -------LESTITPKA-FSKRTEEPNPIMQGTDTIPMPFYLHAKCLKNNTHITLCSPERKIIFRA 132

  Fly   117 SCGIEGF-KNTRKGTNIAAQATAVTISGKAIE------LGWKTVRVKVRGLGPGRMSAIKGLQMG 174
            |.|..|| |..|:|.:     .|.||..|.:|      ||.:.:.|...|....| .|::...:|
pombe   133 SGGTCGFRKGKRRGYD-----AAYTICSKVLEQIQVKRLGIENLHVIFHGFSQAR-EAVQNCLLG 191

  Fly   175 --GL----NIVSITDNTHVSFNPPRPRKQRSL 200
              |.    .||.:.|.|.:.|..||.|::|.:
pombe   192 QEGAVIRDKIVKVMDRTPIKFGGPRGRRERRI 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS11NP_524382.1 Ribosomal_S11 91..198 CDD:294237 32/120 (27%)
mrps18NP_594803.1 RpsK 82..212 CDD:223178 34/136 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0100
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11759
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.960

Return to query results.
Submit another query.