DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS11 and rps1401

DIOPT Version :9

Sequence 1:NP_524382.1 Gene:mRpS11 / 42061 FlyBaseID:FBgn0038474 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_594187.1 Gene:rps1401 / 2540817 PomBaseID:SPAC3H5.05c Length:139 Species:Schizosaccharomyces pombe


Alignment Length:117 Identity:31/117 - (26%)
Similarity:52/117 - (44%) Gaps:9/117 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 ICNIRVSPNNTIISVTDHKGVLRLIRSCGIEGFKNTR-KGTNIAAQATAVTISGKAIELGWKTVR 154
            :.:|..|.|:|.:.:||..|...::|..|....|..| :.:..||...|...:.|..|:|...:.
pombe    18 VAHIFASFNDTFVHITDLTGKETIVRVTGGMKVKTDRDESSPYAAMLAAQDAAAKCKEVGITALH 82

  Fly   155 VKVRGL--------GPGRMSAIKGLQMGGLNIVSITDNTHVSFNPPRPRKQR 198
            :|:|..        |||..:|::.|...|:.|..|.|.|.:..:..|.:..|
pombe    83 IKIRATGGTATKTPGPGAQAALRALARAGMRIGRIEDVTPIPTDSTRRKGGR 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS11NP_524382.1 Ribosomal_S11 91..198 CDD:294237 30/115 (26%)
rps1401NP_594187.1 Ribosomal_S11 2..128 CDD:294237 29/109 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0100
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100266
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.