DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS11 and mrps-11

DIOPT Version :9

Sequence 1:NP_524382.1 Gene:mRpS11 / 42061 FlyBaseID:FBgn0038474 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_506131.1 Gene:mrps-11 / 179711 WormBaseID:WBGene00012244 Length:208 Species:Caenorhabditis elegans


Alignment Length:197 Identity:72/197 - (36%)
Similarity:108/197 - (54%) Gaps:25/197 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 IHTSACWRKAEDRKEMLASLPAKD--------------------EGTVGEKTVDIDTLINRKA-- 68
            :.|::...:.:..:.:.||:.|.|                    |||.|   ..|.|.:|..:  
 Worm    15 LQTASQSMEIQQNRAIHASIRAADSIRDAHRQGTRIGTGQVETMEGTTG---AGIQTAVNTSSID 76

  Fly    69 KFFPDASTANTLFNGIPFNELPICNIRVSPNNTIISVTDHKGVLRLIRSCGIEGFKNTRKGTNIA 133
            ...|.|.|....|:|:.::|||:..||.|.|||:::|.|:|..:....||.:|||||.||.|.||
 Worm    77 ARLPTAETLKQQFDGVAYHELPLVYIRASKNNTLVTVMDNKNEVITSTSCRLEGFKNARKKTTIA 141

  Fly   134 AQATAVTISGKAIELGWKTVRVKVRGLGPGRMSAIKGLQMGGLNIVSITDNTHVSFNPPRPRKQR 198
            .|.|.|....:.:..|.:||||:|:|||||||:.:|||.:.|:::|||:|:|.:....|||||.|
 Worm   142 GQTTGVAAGQRLVRRGIRTVRVQVKGLGPGRMTCVKGLTVAGVHVVSISDHTPLCELGPRPRKIR 206

  Fly   199 SL 200
            .:
 Worm   207 RI 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS11NP_524382.1 Ribosomal_S11 91..198 CDD:294237 51/106 (48%)
mrps-11NP_506131.1 Ribosomal_S11 100..208 CDD:294237 52/107 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157508
Domainoid 1 1.000 106 1.000 Domainoid score I4119
eggNOG 1 0.900 - - E1_COG0100
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H119533
Inparanoid 1 1.050 126 1.000 Inparanoid score I3265
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG29166
OrthoDB 1 1.010 - - D1303296at2759
OrthoFinder 1 1.000 - - FOG0004727
OrthoInspector 1 1.000 - - oto19645
orthoMCL 1 0.900 - - OOG6_100266
Panther 1 1.100 - - LDO PTHR11759
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3942
SonicParanoid 1 1.000 - - X3323
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.