DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ns1 and der

DIOPT Version :9

Sequence 1:NP_732199.2 Gene:Ns1 / 42060 FlyBaseID:FBgn0038473 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_417006.2 Gene:der / 946983 ECOCYCID:G7319 Length:490 Species:Escherichia coli


Alignment Length:290 Identity:69/290 - (23%)
Similarity:111/290 - (38%) Gaps:52/290 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 EQSLKQYFKEFRKVIENADVVLEVVDARDPLGTRCNEVERAVRGAPGNKRLVLVLNKAD-LVPRE 197
            ||||        ..||.|||||.:||||..|......:.:.:|..  .|...||.||.| |.|.:
E. coli    73 EQSL--------LAIEEADVVLFMVDARAGLMPADEAIAKHLRSR--EKPTFLVANKTDGLDPDQ 127

  Fly   198 NLNNWIKYFRRSGPVTAFKASTQDQANRLGRRKLREMKTEKAMQGSVCIGAELLMSMLGNYCRNK 262
            .:.::  |....|.:....||.......|....|.....:.|.|..|...||.....   .....
E. coli   128 AVVDF--YSLGLGEIYPIAASHGRGVLSLLEHVLLPWMEDLAPQEEVDEDAEYWAQF---EAEEN 187

  Fly   263 GIKTS----------IRVGVVGIPNVGKSSIINSLTRGRSCMVGSTPGVTKSMQEVELD---SKI 314
            |.:..          |::.:||.||||||::.|.:......:|...||.|:....:.::   .:.
E. coli   188 GEEEEEDDFDPQSLPIKLAIVGRPNVGKSTLTNRILGEERVVVYDMPGTTRDSIYIPMERDGREY 252

  Fly   315 KLIDCPGIVFTSGGENSHAVLKNAQRVGDVKDPFTIAESVLKRASKEYFCTMYDITNYDTFEEFF 379
            .|||..|:             :...::.|..:.|::.:::  :|.::....|..|   |..|...
E. coli   253 VLIDTAGV-------------RKRGKITDAVEKFSVIKTL--QAIEDANVVMLVI---DAREGIS 299

  Fly   380 AKKAARMGKFLKKGVPDVVAAARSVLNDWN 409
            .:..:.:|..|..|...|:     |:|.|:
E. coli   300 DQDLSLLGFILNSGRSLVI-----VVNKWD 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ns1NP_732199.2 GN3L_Grn1 17..88 CDD:285863
SurA_N_3 59..>150 CDD:304439 5/15 (33%)
RbgA 121..443 CDD:224083 69/290 (24%)
Nucleostemin_like 152..322 CDD:206753 47/183 (26%)
Ras_like_GTPase 271..>400 CDD:206648 28/131 (21%)
derNP_417006.2 PRK00093 3..462 CDD:234628 69/290 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 42 1.000 Domainoid score I753
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.